IGF2BP3 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western blot analysis of Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells); Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) with IGF2BP3 polyclonal antibody (Cat# PAB29324) at 1:100-1:250 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human placenta with IGF2BP3 polyclonal antibody (Cat# PAB29324) shows strong cytoplasmic and nuclear positivity in trophoblastic cell at 1:50-1:200 dilution.
Immunofluorescence
Immunofluorescent staining of human cell line U-251 MG with IGF2BP3 polyclonal antibody (Cat# PAB29324) under 1-4 ug/mL working concentration shows positivity in cytoplasm.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant human IGF2BP3.
Immunogen
Recombinant protein corresponding to amino acids of human IGF2BP3.
Sequence
VVESCEQVNTDSETAVVNVTYSSKDQARQALDKLNGFQLENFTLKVAYIPDEMAAQQNPLQQPRGRRGLGQRGSSRQGSPGSVSKQKPCDLPLRLLVPTQFVGAIIGKEGATIRNITKQTQ
Host
Rabbit
Reactivity
Human, Mouse, Rat
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:50-1:200)
Western Blot (1:100-1:250)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western blot analysis of Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells); Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) with IGF2BP3 polyclonal antibody (Cat# PAB29324) at 1:100-1:250 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human placenta with IGF2BP3 polyclonal antibody (Cat# PAB29324) shows strong cytoplasmic and nuclear positivity in trophoblastic cell at 1:50-1:200 dilution.Immunofluorescence
Immunofluorescent staining of human cell line U-251 MG with IGF2BP3 polyclonal antibody (Cat# PAB29324) under 1-4 ug/mL working concentration shows positivity in cytoplasm. -
Gene Info — IGF2BP3
Entrez GeneID
10643Protein Accession#
O00425Gene Name
IGF2BP3
Gene Alias
DKFZp686F1078, IMP-3, IMP3, KOC1, VICKZ3
Gene Description
insulin-like growth factor 2 mRNA binding protein 3
Omim ID
608259Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is primarily found in the nucleolus, where it can bind to the 5' UTR of the insulin-like growth factor II leader 3 mRNA and may repress translation of insulin-like growth factor II during late development. The encoded protein contains several KH domains, which are important in RNA binding and are known to be involved in RNA synthesis and metabolism. A pseudogene exists on chromosome 7, and there are putative pseudogenes on other chromosomes. [provided by RefSeq
Other Designations
IGF II mRNA binding protein 3|IGF-II mRNA-binding protein 3|KH domain containing protein overexpressed in cancer
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com