NT5E polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western blot analysis of Lane 1: NIH-3T3 cell lysate, Lane 2: NBT-II cell lysate with NT5E polyclonal antibody (Cat# PAB29314) at 1:100 - 1:250 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human duodenum tissue with NT5E polyclonal antibody (Cat# PAB29314) at 1:1000 - 1:2500 dilution.
Immunofluorescence
Immunofluorescence staining of U-2 OS cells with NT5E polyclonal antibody (Cat# PAB29314) under 1-4 ug/mL working concentration.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant human NT5E.
Immunogen
Recombinant protein corresponding to amino acids 118-232 of human NT5E.
Sequence
EFDNGVEGLIEPLLKEAKFPILSANIKAKGPLASQISGLYLPYKVLPVGDEVVGIVGYTSKETPFLSNPGTNLVFEDEITALQPEVDKLKTLNVNKIIALGHSGFEMDKLIAQK
Host
Rabbit
Reactivity
Human, Mouse, Rat
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (1:1000-1:2500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western blot analysis of Lane 1: NIH-3T3 cell lysate, Lane 2: NBT-II cell lysate with NT5E polyclonal antibody (Cat# PAB29314) at 1:100 - 1:250 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human duodenum tissue with NT5E polyclonal antibody (Cat# PAB29314) at 1:1000 - 1:2500 dilution.Immunofluorescence
Immunofluorescence staining of U-2 OS cells with NT5E polyclonal antibody (Cat# PAB29314) under 1-4 ug/mL working concentration. -
Gene Info — NT5E
Entrez GeneID
4907Protein Accession#
P21589Gene Name
NT5E
Gene Alias
CD73, E5NT, NT, NT5, NTE, eN, eNT
Gene Description
5'-nucleotidase, ecto (CD73)
Omim ID
129190Gene Ontology
HyperlinkGene Summary
Ecto-5-prime-nucleotidase (5-prime-ribonucleotide phosphohydrolase; EC 3.1.3.5) catalyzes the conversion at neutral pH of purine 5-prime mononucleotides to nucleosides, the preferred substrate being AMP. The enzyme consists of a dimer of 2 identical 70-kD subunits bound by a glycosyl phosphatidyl inositol linkage to the external face of the plasma membrane. The enzyme is used as a marker of lymphocyte differentiation. Consequently, a deficiency of NT5 occurs in a variety of immunodeficiency diseases (e.g., see MIM 102700, MIM 300300). Other forms of 5-prime nucleotidase exist in the cytoplasm and lysosomes and can be distinguished from ecto-NT5 by their substrate affinities, requirement for divalent magnesium ion, activation by ATP, and inhibition by inorganic phosphate.[supplied by OMIM
Other Designations
5' nucleotidase (CD73)|5' nucleotidase, ecto|OTTHUMP00000016808|OTTHUMP00000040565|Purine 5-Prime-Nucleotidase|ecto-5'-nucleotidase
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com