Product Browser

Last updated: 2017/1/22

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

BTK polyclonal antibody

  • Catalog # : PAB29308
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant human BTK.
  • Immunogen:
  • Recombinant protein corresponding to amino acids 206-351 of human BTK.
  • Sequence:
  • PAAAPVSTSELKKVVALYDYMPMNANDLQLRKGDEYFILEESNLPWWRARDKNGQEGYIPSNYVTEAEDSIEMYEWYSKHMTRSQAEQLLKQEGKEGGFIVRDSSKAGKYTVSVFAKSTGDPQGVIRHYVVCSTPQSQYYLAEKHL
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunofluorescence (1-4 ug/mL)
    Immunohistochemistry (1:200-1:500)
    Western Blot (1:100-1:250)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot
  • Western Blot
  • Western blot analysis of Lane 1: RT-4 cell lysate, Lane 2: U-251 MG sp cell lysate, Lane 3: A-431 cell lysate, Lane 4: Human liver tissue, Lane 5: Human tonsil tissue with BTK polyclonal antibody (Cat# PAB29308) at 1:100 - 1:250 dilution.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human lymph node tissue with BTK polyclonal antibody (Cat# PAB29308) at 1:200 - 1:500 dilution.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescence staining of U-251 MG cells with BTK polyclonal antibody (Cat# PAB29308) under 1-4 ug/mL working concentration.
  • Application Image
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 695
  • Gene Name:
  • BTK
  • Gene Alias:
  • AGMX1,AT,ATK,BPK,IMD1,MGC126261,MGC126262,PSCTK1,XLA
  • Gene Description:
  • Bruton agammaglobulinemia tyrosine kinase
  • Gene Summary:
  • The protein encoded by this gene plays a crucial role in B-cell development. Mutations in this gene cause X-linked agammaglobulinemia type 1, which is an immunodeficiency characterized by the failure to produce mature B lymphocytes, and associated with a failure of Ig heavy chain rearrangement. [provided by RefSeq
  • Other Designations:
  • B-cell progenitor kinase,Bruton tyrosine kinase,OTTHUMP00000023676,OTTHUMP00000063593,agammaglobulinemia tyrosine kinase,dominant-negative kinase-deficient Brutons tyrosine kinase,tyrosine-protein kinase BTK
  • RSS
  • YouTube
  • Linkedin
  • Facebook