Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MEIS2 polyclonal antibody

  • Catalog # : PAB28747
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant MEIS2.
  • Immunogen:
  • Recombinant protein corresponding to amino acids of human MEIS2.
  • Sequence:
  • LEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSV
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (1:200-1:500)
    Immunofluorescence (1-4 ug/ml)
    Western Blot (1:100-1:250)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot
  • Immunohistochemistry
  • Immunohistochemistry
  • Immunohistochemical staining of human pancreas with MEIS2 polyclonal antibody (Cat # PAB28747) shows strong nuclear positivity at 1:200-1:500 dilution.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of human cell line U-2 OS with MEIS2 polyclonal antibody (Cat # PAB28747) at 1-4 ug/mL shows positivity in nucleus but not nucleoli.
  • Application Image
  • Western Blot
  • Gene Information
  • Entrez GeneID:
  • 4212
  • Gene Name:
  • MEIS2
  • Gene Alias:
  • HsT18361,MGC2820,MRG1
  • Gene Description:
  • Meis homeobox 2
  • Gene Summary:
  • This gene encodes a homeobox protein belonging to the TALE ('three amino acid loop extension') family of homeodomain-containing proteins. TALE homeobox proteins are highly conserved transcription regulators, and several members have been shown to be essential contributors to developmental programs. Multiple transcript variants encoding distinct isoforms have been described for this gene. [provided by RefSeq
  • Other Designations:
  • Meis homolog 2,Meis1, myeloid ecotropic viral integration site 1 homolog 2,Meis1-related gene 1,OTTHUMP00000160209,TALE homeobox protein Meis2
  • RSS
  • YouTube
  • Linkedin
  • Facebook