Product Browser

Last updated: 2017/9/17

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FANCB polyclonal antibody

  • Catalog # : PAB28737
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant FANCB.
  • Immunogen:
  • Recombinant protein corresponding to amino acids of human FANCB.
  • Sequence:
  • DSLNSDCLTSFKITDLGKINYSSEPSDCNEDDLFEDKQENRYLVVPPLETGLKVCFSSFRELRQHLLLKEKIISKSYKALINLVQGKDDNTSSAEEKECLVPLCGEEENSVHILDEKLSDNFQDSEQLVEKIWY
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (1:50-1:200)
    Western Blot (1:100-1:250)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot
  • Western Blot
  • Western blot analysis of human cell line RT-4 with FANCB polyclonal antibody (Cat # PAB28737).
  • Immunohistochemistry
  • Immunohistochemistry
  • Immunohistochemical staining of human pancreas with FANCB polyclonal antibody (Cat # PAB28737) shows strong cytoplasmic positivity in exocrine glandular cells.
  • Application Image
  • Gene Information
  • Entrez GeneID:
  • 2187
  • Gene Name:
  • FANCB
  • Gene Alias:
  • FA2,FAAP90,FAAP95,FAB,FACB
  • Gene Description:
  • Fanconi anemia, complementation group B
  • Gene Summary:
  • The Fanconi anemia complementation group (FANC) currently includes FANCA, FANCB, FANCC, FANCD1 (also called BRCA2), FANCD2, FANCE, FANCF, FANCG, FANCI, FANCJ (also called BRIP1), FANCL, FANCM and FANCN (also called PALB2). The previously defined group FANCH is the same as FANCA. Fanconi anemia is a genetically heterogeneous recessive disorder characterized by cytogenetic instability, hypersensitivity to DNA crosslinking agents, increased chromosomal breakage, and defective DNA repair. The members of the Fanconi anemia complementation group do not share sequence similarity; they are related by their assembly into a common nuclear protein complex. This gene encodes the protein for complementation group B. Alternative splicing results in two transcript variants encoding the same protein. [provided by RefSeq
  • Other Designations:
  • Fanconi anemia complementation group B,OTTHUMP00000022953,type 2 Fanconi pancytopenia
  • RSS
  • YouTube
  • Linkedin
  • Facebook