Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

BEGAIN polyclonal antibody

  • Catalog # : PAB28732
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant BEGAIN.
  • Immunogen:
  • Recombinant protein corresponding to amino acids of human BEGAIN.
  • Sequence:
  • PYPAETFRFPASPGPQQALMPPNLWSLRAKPGTARLPGEDMRGQWRPLSVEDIGAYSYPVSAAGRASPCSFSERYYGGAGGSPGKKADGRASPLYASYKADSFSEGDDLSQGHLAEPCFLRAGGDLSLSPGRSADPLPGYAPSE
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (1:200-1:500)
    Immunofluorescence (1-4 ug/ml)
    Western Blot (1:100-1:250)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western blot analysis of Lane 1: Negative control (vector only transfected HEK293T lysate), Lane 2: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY412260) with BEGAIN polyclonal antibody (Cat # PAB28732) at 1:100-1:250 dilution.
  • Immunohistochemistry
  • Immunohistochemistry
  • Immunohistochemical staining of human stomach with BEGAIN polyclonal antibody (Cat # PAB28732) shows strong cytoplasmic positivity in granular pattern in glandular cells at 1:200-1:500 dilution.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of human cell line A-431 with BEGAIN polyclonal antibody (Cat # PAB28732) at 1-4 ug/mL shows positivity in nucleus but not nucleoli and golgi apparatus.
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • BEGAIN
  • Gene Alias:
  • KIAA1446
  • Gene Description:
  • brain-enriched guanylate kinase-associated homolog (rat)
  • Other Designations:
  • brain-enriched guanylate kinase-associated homolog,brain-enriched guanylate kinase-associated protein,likely ortholog of rat brain-enriched guanylate kinase-associated protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook