NDRG2 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant NDRG2.
Immunogen
Recombinant protein corresponding to amino acids of human NDRG2.
Sequence
TGLTSSIPEMILGHLFSQEELSGNSELIQKYRNIITHAPNLDNIELYWNSYNNRRDLNFERGGDITLRCPVMLVVGDQAPHEDAVVECNSKLDPTQTSFLKMADSGGQP
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:2500-1:5000)
Immunofluorescence (1-4 ug/ml)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot
Western blot analysis of Lane 1: Human cell line RT-4, Lane 2: Human cell line U-251MG sp, Lane 3: Human cell line A-431, Lane 4: Human liver tissue, Lane5: Human tonsil tissue with NDRG2 polyclonal antibody (Cat # PAB28730) at 1:2500-1:5000 dilution.Immunohistochemistry
Immunohistochemical staining of human salivary gland with NDRG2 polyclonal antibody (Cat # PAB28730) shows strong cytoplasmic positivity in glandular cells at 1:2500-1:5000 dilution.Immunofluorescence
Immunofluorescent staining of human cell line U-251MG with NDRG2 polyclonal antibody (Cat # PAB28730) at 1-4 ug/mL shows positivity in nucleus but not nucleoli, cytoplasm and centrosome. -
Gene Info — NDRG2
Entrez GeneID
57447Gene Name
NDRG2
Gene Alias
DKFZp781G1938, FLJ25522, KIAA1248, SYLD
Gene Description
NDRG family member 2
Omim ID
605272Gene Ontology
HyperlinkGene Summary
This gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. The protein encoded by this gene is a cytoplasmic protein that may play a role in neurite outgrowth. This gene may be involved in glioblastoma carcinogenesis. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. [provided by RefSeq
Other Designations
N-myc downstream regulator 2|N-myc downstream-regulated gene 2|NDR1-related protein NDR2|OTTHUMP00000164407|cytoplasmic protein Ndr1|syld709613 protein
-
Interactome
-
Publication Reference
-
Combined Aberrant Expression of NDRG2 and LDHA Predicts Hepatocellular Carcinoma Prognosis and Mediates the Anti-tumor Effect of Gemcitabine.
Guo Y, Li X, Sun X, Wang J, Yang X, Zhou X, Liu X, Liu W, Yuan J, Yao L, Li X, Shen L.
International Journal of Biological Sciences 2019 Jul; 15(9):1771.
Application:IHC, WB, Human, HepG2, HCC, HHCC, Huh7, QSG-7701 cells, Liver.
-
Combined Aberrant Expression of NDRG2 and LDHA Predicts Hepatocellular Carcinoma Prognosis and Mediates the Anti-tumor Effect of Gemcitabine.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com