Product Browser

Last updated: 2017/6/18

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NDRG2 polyclonal antibody

  • Catalog # : PAB28730
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant NDRG2.
  • Immunogen:
  • Recombinant protein corresponding to amino acids of human NDRG2.
  • Sequence:
  • TGLTSSIPEMILGHLFSQEELSGNSELIQKYRNIITHAPNLDNIELYWNSYNNRRDLNFERGGDITLRCPVMLVVGDQAPHEDAVVECNSKLDPTQTSFLKMADSGGQP
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (1:2500-1:5000)
    Immunofluorescence (1-4 ug/ml)
    Western Blot (1:100-1:250)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot
  • Western Blot
  • Western blot analysis of Lane 1: Human cell line RT-4, Lane 2: Human cell line U-251MG sp, Lane 3: Human cell line A-431, Lane 4: Human liver tissue, Lane5: Human tonsil tissue with NDRG2 polyclonal antibody (Cat # PAB28730) at 1:2500-1:5000 dilution.
  • Immunohistochemistry
  • Immunohistochemistry
  • Immunohistochemical staining of human salivary gland with NDRG2 polyclonal antibody (Cat # PAB28730) shows strong cytoplasmic positivity in glandular cells at 1:2500-1:5000 dilution.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of human cell line U-251MG with NDRG2 polyclonal antibody (Cat # PAB28730) at 1-4 ug/mL shows positivity in nucleus but not nucleoli, cytoplasm and centrosome.
  • Application Image
  • Gene Information
  • Gene Name:
  • NDRG2
  • Gene Alias:
  • DKFZp781G1938,FLJ25522,KIAA1248,SYLD
  • Gene Description:
  • NDRG family member 2
  • Gene Summary:
  • This gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. The protein encoded by this gene is a cytoplasmic protein that may play a role in neurite outgrowth. This gene may be involved in glioblastoma carcinogenesis. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. [provided by RefSeq
  • Other Designations:
  • N-myc downstream regulator 2,N-myc downstream-regulated gene 2,NDR1-related protein NDR2,OTTHUMP00000164407,cytoplasmic protein Ndr1,syld709613 protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook