Product Browser

Last updated: 2016/9/25

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

OLIG2 polyclonal antibody

  • Catalog # : PAB28727
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant OLIG2.
  • Immunogen:
  • Recombinant protein corresponding to amino acids of human OLIG2.
  • Sequence:
  • SPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPELSAELRGAMGSAGAHPGDKLGGSGFKSSSSSTSSSTSSAAASSTKKDKKQMTEPELQQLRLKINSRERKRMHDLNI
  • Host:
  • Rabbit
  • Reactivity:
  • Human, Rat
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (1:1000-1:2500)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Immunohistochemistry
  • Application Image
  • Immunohistochemistry
  • Gene Information
  • Gene Name:
  • OLIG2
  • Gene Alias:
  • BHLHB1,OLIGO2,PRKCBP2,RACK17,bHLHe19
  • Gene Description:
  • oligodendrocyte lineage transcription factor 2
  • Gene Summary:
  • This gene encodes a basic helix-loop-helix transcription factor which is expressed in oligodendroglial tumors of the brain. The protein is an essential regulator of ventral neuroectodermal progenitor cell fate. The gene is involved in a chromosomal translocation t(14;21)(q11.2;q22) associated with T-cell acute lymphoblastic leukemia. Its chromosomal location is within a region of chromosome 21 which has been suggested to play a role in learning deficits associated with Down syndrome. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000067569,OTTHUMP00000067570,basic domain, helix-loop-helix protein, class B, 1,human protein kinase C-binding protein RACK17,oligodendrocyte-specific bHLH transcription factor 2,protein kinase C binding protein 2
  • RSS
  • YouTube
  • Linkedin
  • Facebook