Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PCMT1 polyclonal antibody

  • Catalog # : PAB28722
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant PCMT1.
  • Immunogen:
  • Recombinant protein corresponding to amino acids of human PCMT1.
  • Sequence:
  • AKALDVGSGSGILTACFARMVGCTGKVIGIDHIKELVDDSVNNVRKDDPTLLSSGRVQLVVGDGRMGYAEEAPYDAIHVGAAAPVVPQALIDQLKPGGRLILPVGPAGGNQMLEQYDKLQDGSIKMKPLMGVIYVPLTDKEKQWS
  • Host:
  • Rabbit
  • Reactivity:
  • Human, Mouse, Rat
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (1:200-1:500)
    Immunofluorescence (1-4 ug/ml)
    Western Blot (1:100-1:500)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western blot analysis of Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
    Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
    Lane 3: PC12 cell lysate (Pheochromocytoma of rat adrenal medulla)
    with PCMT1 polyclonal antibody (Cat # PAB28722) at 1:100-1:500 dilution.
  • Immunohistochemistry
  • Immunohistochemistry
  • Immunohistochemical staining of human stomach with PCMT1 polyclonal antibody (Cat # PAB28722) shows cytoplasmic positivity in glandular cells at 1:200-1:500 dilution.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of human cell line A-431 with PCMT1 polyclonal antibody (Cat # PAB28722) at 1-4 ug/mL dilution shows positivity in cytoplasm.
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 5110
  • Gene Name:
  • PCMT1
  • Gene Alias:
  • -
  • Gene Description:
  • protein-L-isoaspartate (D-aspartate) O-methyltransferase
  • Gene Summary:
  • Three classes of protein carboxyl methyltransferases, distinguished by their methyl-acceptor substrate specificity, have been found in prokaryotic and eukaryotic cells. The type II enzyme catalyzes the transfer of a methyl group from S-adenosyl-L-methionine to the free carboxyl groups of D-aspartyl and L-isoaspartyl residues. These methyl-accepting residues result from the spontaneous deamidation, isomerization, and racemization of normal L-aspartyl and L-asparaginyl residues and represent sites of covalent damage to aging proteins PCMT1 (EC 2.1.1.77) is a protein repair enzyme that initiates the conversion of abnormal D-aspartyl and L-isoaspartyl residues to the normal L-aspartyl form.[supplied by OMIM
  • Other Designations:
  • L-isoaspartyl/D-aspartyl methyltransferase,OTTHUMP00000017398,OTTHUMP00000017400
  • RSS
  • YouTube
  • Linkedin
  • Facebook