Product Browser

Last updated: 2017/5/21

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ZKSCAN5 polyclonal antibody

  • Catalog # : PAB28714
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant ZKSCAN5.
  • Immunogen:
  • Recombinant protein corresponding to amino acids of human ZKSCAN5.
  • Sequence:
  • EHHPESGEEAVAVIENIQRELEERRQQIVACPDVLPRKMATPGAVQESCSPHPLTVDTQPEQAPQKPRLLEENALPVLQVPSLPLKDSQELTASLLSTGSQKLVKIEEVADVAVSFILEEWGHLDQSQKSLYRDDRKENYGSITS
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (1:200-1:500)
    Western Blot (1:100-1:250)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western blot analysis of Lane 1: Human cell line RT-4
    Lane 2: Human cell line U-251MG sp
    with ZKSCAN5 polyclonal antibody (Cat # PAB28714).
  • Immunohistochemistry
  • Immunohistochemistry
  • Immunohistochemical staining of human esophagus with ZKSCAN5 polyclonal antibody (Cat # PAB28714) show strong cytoplasmic and nuclear positivity in squamous epithelial cells.
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • ZKSCAN5
  • Gene Alias:
  • FLJ39233,KIAA1015,MGC33710,ZFP95
  • Gene Description:
  • zinc finger with KRAB and SCAN domains 5
  • Gene Summary:
  • This gene encodes a zinc finger protein of the Kruppel family. The protein contains a SCAN box and a KRAB A domain. A similar protein in mouse is differentially expressed in spermatogenesis. Two alternatively spliced transcript variants differing only in the 5' UTR have been described. Additional variants have been found, but their full-length sequences have not been determined. [provided by RefSeq
  • Other Designations:
  • zinc finger protein 95 homolog,zinc finger protein homologous to Zfp95 in mouse
  • RSS
  • YouTube
  • Linkedin
  • Facebook