Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MED15 polyclonal antibody

  • Catalog # : PAB28707
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant MED15.
  • Immunogen:
  • Recombinant protein corresponding to amino acids of human MED15.
  • Sequence:
  • QKLVSQIEDAMRKAGVAHSKSSKDMESHVFLKAKTRDEYLSLVARLIIHFRDIHNKKSQASVSDPMNALQSLTGGPAAGAAGIGMPPRGPGQSLGGMGSLGAMGQPMSLSGQP
  • Host:
  • Rabbit
  • Reactivity:
  • Human, Mouse, Rat
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (1:10-1:20)
    Immunofluorescence (1-4 ug/ml)
    Western Blot (1:100-1:500)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western blot analysis of Lane 1: Human cell line RT-4
    Lane 2: Human cell line U-251MG sp
    Lane 3: Human cell line A-431
    with MED15 polyclonal antibody (Cat # PAB28707) at 1:100-1:250 dilution.
  • Immunohistochemistry
  • Immunohistochemistry
  • Immunohistochemical staining of human placenta with MED15 polyclonal antibody (Cat # PAB28707) shows strong nuclear and cytoplasmic positivity in trophoblastic cells at 1:10-1:20 dilution.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of human cell line U-251MG with MED15 polyclonal antibody (Cat # PAB28707) at 1-4 ug/mL dilution shows positivity in nucleus but not nucleoli.
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • MED15
  • Gene Alias:
  • ARC105,CAG7A,CTG7A,DKFZp686A2214,DKFZp762B1216,FLJ42282,FLJ42935,PCQAP,TIG-1,TIG1,TNRC7
  • Gene Description:
  • mediator complex subunit 15
  • Gene Summary:
  • The protein encoded by this gene is a subunit of the multiprotein complexes PC2 and ARC/DRIP and may function as a transcriptional coactivator in RNA polymerase II transcription. This gene contains stretches of trinucleotide repeats and is located in the chromosome 22 region which is deleted in DiGeorge syndrome. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • CTG repeat protein 7a,PC2 (positive cofactor 2, multiprotein complex) glutamine/Q-rich-associated protein,PC2-glutamine-rich-associated protein,TPA inducible gene-1,TPA inducible protein,activator-recruited cofactor, 105-kD,positive cofactor 2, glutamine/
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook