MED15 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western blot analysis of Lane 1: Human cell line RT-4
Lane 2: Human cell line U-251MG sp
Lane 3: Human cell line A-431
with MED15 polyclonal antibody (Cat # PAB28707) at 1:100-1:250 dilution.
Immunohistochemistry
Immunohistochemical staining of human placenta with MED15 polyclonal antibody (Cat # PAB28707) shows strong nuclear and cytoplasmic positivity in trophoblastic cells at 1:10-1:20 dilution.
Immunofluorescence
Immunofluorescent staining of human cell line U-251MG with MED15 polyclonal antibody (Cat # PAB28707) at 1-4 ug/mL dilution shows positivity in nucleus but not nucleoli.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant MED15.
Immunogen
Recombinant protein corresponding to amino acids of human MED15.
Sequence
QKLVSQIEDAMRKAGVAHSKSSKDMESHVFLKAKTRDEYLSLVARLIIHFRDIHNKKSQASVSDPMNALQSLTGGPAAGAAGIGMPPRGPGQSLGGMGSLGAMGQPMSLSGQP
Host
Rabbit
Reactivity
Human, Mouse, Rat
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:10-1:20)
Immunofluorescence (1-4 ug/ml)
Western Blot (1:100-1:500)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western blot analysis of Lane 1: Human cell line RT-4
Lane 2: Human cell line U-251MG sp
Lane 3: Human cell line A-431
with MED15 polyclonal antibody (Cat # PAB28707) at 1:100-1:250 dilution.Immunohistochemistry
Immunohistochemical staining of human placenta with MED15 polyclonal antibody (Cat # PAB28707) shows strong nuclear and cytoplasmic positivity in trophoblastic cells at 1:10-1:20 dilution.Immunofluorescence
Immunofluorescent staining of human cell line U-251MG with MED15 polyclonal antibody (Cat # PAB28707) at 1-4 ug/mL dilution shows positivity in nucleus but not nucleoli. -
Gene Info — MED15
Entrez GeneID
51586Gene Name
MED15
Gene Alias
ARC105, CAG7A, CTG7A, DKFZp686A2214, DKFZp762B1216, FLJ42282, FLJ42935, PCQAP, TIG-1, TIG1, TNRC7
Gene Description
mediator complex subunit 15
Omim ID
607372Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a subunit of the multiprotein complexes PC2 and ARC/DRIP and may function as a transcriptional coactivator in RNA polymerase II transcription. This gene contains stretches of trinucleotide repeats and is located in the chromosome 22 region which is deleted in DiGeorge syndrome. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
CTG repeat protein 7a|PC2 (positive cofactor 2, multiprotein complex) glutamine/Q-rich-associated protein|PC2-glutamine-rich-associated protein|TPA inducible gene-1|TPA inducible protein|activator-recruited cofactor, 105-kD|positive cofactor 2, glutamine/
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com