Product Browser

Last updated: 2016/9/25

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RPS6KA6 polyclonal antibody

  • Catalog # : PAB28694
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant RPS6KA6.
  • Immunogen:
  • Recombinant protein corresponding to amino acids of human RPS6KA6.
  • Sequence:
  • PFKPASGKPDDTFCFDPEFTAKTPKDSPGLPASANAHQLFKGFSFVATSIAEEYKITPITSANVLPIVQINGNAAQFGEVYELKEDIGVGSYSVCKRCIHATTNMEFAVKIIDKSK
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (1:20-1:50)
    Immunofluorescence (1-4 ug/ml)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Immunohistochemistry
  • Immunohistochemistry
  • Immunohistochemical staining of human stomach with RPS6KA6 polyclonal antibody (Cat # PAB28694) shows strong cytoplasmic and membranous positivity in glandular cells.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of human cell line U-2 OS with RPS6KA6 polyclonal antibody (Cat # PAB28694) at 1-4 ug/mL shows positivity in nucleus, nucleoli & mitochondria.
  • Application Image
  • Gene Information
  • Gene Name:
  • RPS6KA6
  • Gene Alias:
  • RSK4
  • Gene Description:
  • ribosomal protein S6 kinase, 90kDa, polypeptide 6
  • Other Designations:
  • OTTHUMP00000023618,bA326A14.2 (ribosomal protein S6 kinase, 90kD, polypeptide 6),bA54F22.1.1 (ribosomal protein S6 kinase, 90kD, polypeptide 6),ribosomal S6 kinase 4,ribosomal protein S6 kinase, 90kD, polypeptide 6
  • RSS
  • YouTube
  • Linkedin
  • Facebook