Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TROVE2 polyclonal antibody

  • Catalog # : PAB28693
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant TROVE2.
  • Immunogen:
  • Recombinant protein corresponding to amino acids of human TROVE2.
  • Sequence:
  • FLLAVDVSASMNQRVLGSILNASTVAAAMCMVVTRTEKDSYVVAFSDEMVPCPVTTDMTLQQVLMAMSQIPAGGTDCSLPMIWAQKTNTPADVFIVFTDNETFAGGVHPAIALREYRKKMDIPAKLIVCGMTSNGF
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (1:500-1:1000)
    Immunofluorescence (1-4 ug/ml)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Immunohistochemistry
  • Immunohistochemistry
  • Immunohistochemical staining of human liver with TROVE2 polyclonal antibody (Cat # PAB28693) shows strong cytoplasmic positivity in hepatocytes.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of human cell line A-431 with TROVE2 polyclonal antibody (Cat # PAB28693) at 1-4 ug/mL shows positivity in cytoplasm.
  • Application Image
  • Gene Information
  • Entrez GeneID:
  • 6738
  • Gene Name:
  • TROVE2
  • Gene Alias:
  • RO60,SSA2
  • Gene Description:
  • TROVE domain family, member 2
  • Other Designations:
  • OTTHUMP00000033759,OTTHUMP00000033760,OTTHUMP00000033764,Sjogren syndrome antigen A2 (60kD, ribonucleoprotein autoantigen SS-A/Ro),Sjogren syndrome antigen A2 (60kDa, ribonucleoprotein autoantigen SS-A/Ro),bA101E13.2 (Sjogren syndrome antigen A2 (60kD, ri
  • RSS
  • YouTube
  • Linkedin
  • Facebook