Product Browser

Last updated: 2017/5/21

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SLC15A1 polyclonal antibody

  • Catalog # : PAB28691
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant SLC15A1.
  • Immunogen:
  • Recombinant protein corresponding to amino acids of human SLC15A1.
  • Sequence:
  • DKTLPVFPKGNEVQIKVLNIGNNTMNISLPGEMVTLGPMSQTNAFMTFDVNKLTRINISSPGSPVTAVTDDFKQGQRHTLLVWAPNHYQVVKDGLNQKPEKGENGIRFVNTFNELITITMSGKVYANISSYNA
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (1:200-1:500)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Immunohistochemistry
  • Immunohistochemistry
  • Immunohistochemical staining of human kidney with SLC15A1 polyclonal antibody (Cat # PAB28691) shows moderate cytoplasmic positivity in distal tubules.
  • Application Image
  • Gene Information
  • Entrez GeneID:
  • 6564
  • Gene Name:
  • SLC15A1
  • Gene Alias:
  • HPECT1,HPEPT1,PEPT1
  • Gene Description:
  • solute carrier family 15 (oligopeptide transporter), member 1
  • Other Designations:
  • OTTHUMP00000018599,bA551M18.1.1 (solute carrier family 15 (oligopeptide transporter) member 1),peptide transporter HPEPT1
  • RSS
  • YouTube
  • Linkedin
  • Facebook