Product Browser

Last updated: 2017/7/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

EMILIN1 polyclonal antibody

  • Catalog # : PAB28690
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant EMILIN1.
  • Immunogen:
  • Recombinant protein corresponding to amino acids of human EMILIN1.
  • Sequence:
  • PQSIMYRRFLRPRYRVAYKTVTDMEWRCCQGYGGDDCAESPAPALGPASSTPRPLARPARPNLSGSSAGSPLSGLGGEGPGESEKVQQLEEQVQSLTKELQGLRGVLQGLSGRLAEDVQRAVETAFNGRQQPADAAARPGVHETLNE
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (1:200-1:500)
    Western Blot (1:100-1:250)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot
  • Western Blot
  • Western blot anyalysis of Lane 1: Human cell line RT-4, Lane 2: Human cell line U-251MG sp, Lane 3: Human cell line A-431, Lane 4: Human liver tissue, Lane 5: Human tonsil tissue with EMILIN1 polyclonal antibody (Cat # PAB28690).
  • Immunohistochemistry
  • Immunohistochemistry
  • Immunohistochemical staining of human bone marrow with EMILIN1 polyclonal antibody (Cat # PAB28690) shows moderate cytoplasmic positivity in megakaryocytes.
  • Application Image
  • Gene Information
  • Gene Name:
  • EMILIN1
  • Gene Alias:
  • DKFZp586M121,EMILIN,EMILIN-1,gp115
  • Gene Description:
  • elastin microfibril interfacer 1
  • Gene Summary:
  • This gene encodes an extracellular matrix glycoprotein that is characterized by an N-terminal microfibril interface domain, a coiled-coiled alpha-helical domain, a collagenous domain and a C-terminal globular C1q domain. The encoded protein associates with elastic fibers at the interface between elastin and microfibrils and may play a role in the development of elastic tissues including large blood vessels, dermis, heart and lung. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000122584,TNF? elastin microfibril interface located protein,elastin microfibril interface located protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook