Product Browser

Last updated: 2017/9/24

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FTSJ1 polyclonal antibody

  • Catalog # : PAB28683
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant FTSJ1.
  • Immunogen:
  • Recombinant protein corresponding to amino acids of human FTSJ1.
  • Sequence:
  • FNQLDGPTRIIVPFVTCGDLSSYDSDRSYPLDLEGGSEYKYTPPTQPPISPPYQEACTLKRKGQLAKEIRPQDCPISRVDTFPQPLAAPQCHTLLAPEMEDNEMSCSP
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (1:20-1:50)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Immunohistochemistry
  • Immunohistochemistry
  • Immunohistochemical staining of human liver with FTSJ1 polyclonal antibody (Cat # PAB28683) shows strong nuclear and cytoplasmic positivity in hepatocytes and extracellular positivity in blood vessels .
  • Application Image
  • Gene Information
  • Gene Name:
  • FTSJ1
  • Gene Alias:
  • CDLIV,JM23,MRX44,MRX9,SPB1,TRM7
  • Gene Description:
  • FtsJ homolog 1 (E. coli)
  • Gene Summary:
  • The protein encoded by this gene is a member of the S-adenosylmethionine-binding protein family. It is a nucleolar protein and may be involved in the processing and modification of rRNA. Three alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq
  • Other Designations:
  • FtsJ homolog 1,OTTHUMP00000025795,OTTHUMP00000025796,cell division protein,rRNA (uridine-2'-O-)-methyltransferase
  • RSS
  • YouTube
  • Linkedin
  • Facebook