Product Browser

Last updated: 2017/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

AURKA polyclonal antibody

  • Catalog # : PAB28676
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant AURKA.
  • Immunogen:
  • Recombinant protein corresponding to amino acids of human AURKA.
  • Sequence:
  • ISGPVKATAPVGGPKRVLVTQQFPCQNPLPVNSGQAQRVLCPSNSSQRVPLQAQKLVSSHKPVQNQKQKQLQATSVPHPVSRPLNNTQKSKQPLPSAPENNPEEELASKQKNEESKKRQWALEDFEIGRPLGKGKFGNVYL
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (1:200-1:500) Western Blot (1:100-1:250)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot
  • Western Blot
  • Western blot analysis of Lane 1: Human cell line RT-4, Lane 2: Human cell line U-251MG sp with AURKA polyclonal antibody (Cat # PAB28676).
  • Immunohistochemistry
  • Immunohistochemistry
  • Immunohistochemical staining of human hippocampus with AURKA polyclonal antibody (Cat # PAB28676) shows strong cytoplasmic and nuclear positivity in neuronal cells.
  • Application Image
  • Gene Information
  • Entrez GeneID:
  • 6790
  • Gene Name:
  • AURKA
  • Gene Alias:
  • AIK,ARK1,AURA,AURORA2,BTAK,MGC34538,STK15,STK6,STK7
  • Gene Description:
  • aurora kinase A
  • Gene Summary:
  • The protein encoded by this gene is a cell cycle-regulated kinase that appears to be involved in microtubule formation and/or stabilization at the spindle pole during chromosome segregation. The encoded protein is found at the centrosome in interphase cells and at the spindle poles in mitosis. This gene may play a role in tumor development and progression. A processed pseudogene of this gene has been found on chromosome 1, and an unprocessed pseudogene has been found on chromosome 10. Multiple transcript variants encoding the same protein have been found for this gene. [provided by RefSeq
  • Other Designations:
  • IPL1-related kinase,OTTHUMP00000031340,OTTHUMP00000031342,OTTHUMP00000031343,OTTHUMP00000031344,OTTHUMP00000031345,OTTHUMP00000166071,aurora-A,aurora-related kinase 1,aurora/IPL1-like kinase,breast-tumor-amplified kinase,serine/threonine kinase 15,serine/
  • RSS
  • YouTube
  • Linkedin
  • Facebook