Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RNASEL polyclonal antibody

  • Catalog # : PAB28675
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant RNASEL.
  • Immunogen:
  • Recombinant protein corresponding to amino acids of human RNASEL.
  • Sequence:
  • HGAKEDFHPPAEDWKPQSSHWGAALKDLHRIYRPMIGKLKFFIDEKYKIADTSEGGIYLGFYEKQEVAVKTFCEGSPRAQREVSCLQSSRENSHLVTFYGSESHRGHLFVCVTLCEQTLEACLDVHRGEDVENEEDEFARNVLSSI
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry
    Western Blot
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot
  • Western Blot
  • Western blot analysis of Lane 1: Human cell line RT-4, Lane 2: Human cell line U-251MG sp with RNASEL polyclonal antibody (Cat # PAB28675).
  • Immunohistochemistry
  • Immunohistochemistry
  • Immunohistochemical staining of human bronchus with RNASEL polyclonal antibody (Cat # PAB28675) shows cytoplasmic and membranous positivity in respiratory epithelial cells.
  • Application Image
  • Gene Information
  • Entrez GeneID:
  • 6041
  • Gene Name:
  • RNASEL
  • Gene Alias:
  • DKFZp781D08126,MGC104972,MGC133329,PRCA1,RNS4
  • Gene Description:
  • ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent)
  • Gene Summary:
  • This gene encodes a component of the interferon-regulated 2-5A system that functions in the antiviral and antiproliferative roles of interferons. Mutations in this gene have been associated with predisposition to prostate cancer and this gene is a candidate for the hereditary prostate cancer 1 (HPC1) allele. [provided by RefSeq
  • Other Designations:
  • 2',5'-oligoisoadenylate synthetase-dependent,OTTHUMP00000033148,interferon-induced 2-5A-dependent RNase,ribonuclease 4,ribonuclease L
  • RSS
  • YouTube
  • Linkedin
  • Facebook