Product Browser

Last updated: 2017/5/21

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DFNB31 polyclonal antibody

  • Catalog # : PAB28671
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant DFNB31.
  • Immunogen:
  • Recombinant protein corresponding to amino acids of human DFNB31.
  • Sequence:
  • VDPGSEAEGSGLKVGDQILEVNGRSFLNILHDEAVRLLKSSRHLILTVKDVGRLPHARTTVDETKWIASSRIRETMANSAGFLGDLTTEGINKPGFYKGPAGSQVTLSSLGNQTRVLLEEQARHLLNEQEH
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (1:200-1:500)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Immunohistochemistry
  • Immunohistochemistry
  • Immunohistochemical staining of human duodenum with DFNB31 polyclonal antibody (Cat # PAB28671) shows strong granular positivity in glandular cells at 1:200-1:500 dilution.
  • Application Image
  • Gene Information
  • Gene Name:
  • DFNB31
  • Gene Alias:
  • CIP98,DKFZp434N014,KIAA1526,RP11-9M16.1,USH2D,WHRN,WI
  • Gene Description:
  • deafness, autosomal recessive 31
  • Gene Summary:
  • In rat brain, Cip98 interacts with a calmodulin-dependent serine kinase, CASK (MIM 300172), and may be involved in the formation of scaffolding protein complexes that facilitate synaptic transmission in the central nervous system (CNS) (Yap et al., 2003 [PubMed 12641734]). Mutations in this gene, also known as WHRN, cause DFNB31 (MIM 607084).[supplied by OMIM
  • Other Designations:
  • CASK-interacting protein CIP98,OTTHUMP00000021976,OTTHUMP00000021978,whirlin
  • RSS
  • YouTube
  • Linkedin
  • Facebook