Product Browser

Last updated: 2017/5/28

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ABCC4 polyclonal antibody

  • Catalog # : PAB28670
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant ABCC4.
  • Immunogen:
  • Recombinant protein corresponding to amino acids of human ABCC4.
  • Sequence:
  • NFSVGQRQLVCLARAILRKNQILIIDEATANVDPRTDELIQKKIREKFAHCTVLTIAHRLNTIIDSDKIMVLDSGRLKEYDEPYVLLQNKESLFYKMVQQLGKAEAAALTETAKQVYFKRNYPHIGHTDHMVTNTSNGQPST
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (1:200-1:500)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Publication Reference
  • Applications
  • Immunohistochemistry
  • Immunohistochemistry
  • Immunohistochemical staining of human prostate with ABCC4 polyclonal antibody (Cat # PAB28670) shows cytoplasmic and membranous positivity in glandular cells at 1:200-1:500 dilution.
  • Application Image
  • Gene Information
  • Gene Name:
  • ABCC4
  • Gene Alias:
  • EST170205,MOAT-B,MOATB,MRP4
  • Gene Description:
  • ATP-binding cassette, sub-family C (CFTR/MRP), member 4
  • Gene Summary:
  • The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. The specific function of this protein has not yet been determined; however, this protein may play a role in cellular detoxification as a pump for its substrate, organic anions. Alternative splicing results in multiple splice variants encoding different isoforms. [provided by RefSeq
  • Other Designations:
  • ATP-binding cassette, sub-family C, member 4,OTTHUMP00000018560,bA464I2.1 (ATP-binding cassette, sub-family C (CFTR/MRP), member 4),canalicular multispecific organic anion transporter (ABC superfamily),multidrug resistance-associated protein 4,multispecif
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook