Product Browser

Last updated: 2017/11/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GCET2 polyclonal antibody

  • Catalog # : PAB28669
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant GCET2.
  • Immunogen:
  • Recombinant protein corresponding to amino acids of human GCET2.
  • Sequence:
  • HIAEGCFCLPWKKILIFEKRQDSQNENERMSSTPIQDNVDQTYSEELCYTLINHRVLCTRPSGNSAEEYYENVPCKAERPRESLGGTETEYSLLHMPSTDPRHARSPEDEYELLMPHRISSHFL
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (1:200-1:500)
    Western Blot (1:100-1:250)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot
  • Western Blot
  • Western blot analysis of human cell line RT-4 with GCET2 polyclonal antibody (Cat # PAB28669).
  • Immunohistochemistry
  • Immunohistochemistry
  • Immunohistochemical staining of human tonsil with GCET2 polyclonal antibody (Cat # PAB28669) shows cytoplasmic positivity in reaction center cells.
  • Application Image
  • Gene Information
  • Gene Name:
  • GCET2
  • Gene Alias:
  • GCAT2,HGAL,MGC40441
  • Gene Description:
  • germinal center expressed transcript 2
  • Gene Summary:
  • This gene encodes a protein which may function in signal transduction pathways and whose expression is elevated in germinal cell lymphomas. It contains a putative PDZ-interacting domain, an immunoreceptor tyrosine-based activation motif (ITAM), and two putative SH2 binding sites. In B cells, its expression is specifically induced by interleukin-4. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq
  • Other Designations:
  • germinal center B cell associated-protein 2,germinal center-associated lymphoma
  • RSS
  • YouTube
  • Linkedin
  • Facebook