SNW1 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant SNW1.
Immunogen
Recombinant protein corresponding to amino acids of human SNW1.
Sequence
RNLSRAAPDKRSKLQRNENRDISEVIALGVPNPRTSNEVQYDQRLFNQSKGMDSGFAGGEDEIYNVYDQAWRGGKDMAQSIYRPSKNLDKDMYGDDLEARIKTNRFVPDKEFSGSDRRQRGREGPVQFEEDPFGLDKF
Host
Rabbit
Reactivity
Human, Mouse, Rat
Form
liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)(1:50-1:200)
Immunofluorescence (1-4 ug/ml)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western blot analysis of Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells), Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells), Lane 3: PC12 cell lysate (Pheochromocytoma of rat adrenal medulla) with SNW1 polyclonal antibody (Cat # PAB28666) at 1:100-1:500 dilution.Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251MG sp, Lane 3: A-431 with SNW1 polyclonal antibody (Cat # PAB28666) at 1:100-1:250 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human duodenum with SNW1 polyclonal antibody (Cat # PAB28666) shows strong nuclear and cytoplasmic positivity in glandular cells at 1:50-1:200 dilution.Immunofluorescence
Immunofluorescent staining of human cell line U373 MG with SNW1 polyclonal antibody (Cat # PAB28666) at 1-4 ug/mL shows positivity in nucleus. -
Gene Info — SNW1
Entrez GeneID
22938Gene Name
SNW1
Gene Alias
Bx42, MGC119379, NCOA-62, PRPF45, Prp45, SKIIP, SKIP
Gene Description
SNW domain containing 1
Omim ID
603055Gene Ontology
HyperlinkGene Summary
This gene, a member of the SNW gene family, encodes a coactivator that enhances transcription from some Pol II promoters. This coactivator can bind to the ligand-binding domain of the vitamin D receptor and to retinoid receptors to enhance vitamin D-, retinoic acid-, estrogen-, and glucocorticoid-mediated gene expression. It can also function as a splicing factor by interacting with poly(A)-binding protein 2 to directly control the expression of muscle-specific genes at the transcriptional level. Finally, the protein may be involved in oncogenesis since it interacts with a region of SKI oncoproteins that is required for transforming activity. [provided by RefSeq
Other Designations
SKI interacting protein|SKI-interacting protein|homolog of Drosophila BX42|nuclear protein SkiP|nuclear receptor coactivator, 62-kD
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com