Product Browser

Last updated: 2017/7/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SLMAP polyclonal antibody

  • Catalog # : PAB28662
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant SLMAP.
  • Immunogen:
  • Recombinant protein corresponding to amino acids of human SLMAP.
  • Sequence:
  • SEYEKEITSLQNSFQLRCQQCEDQQREEATRLQGELEKLRKEWNALETECHSLKRENVLLSSELQRQEKELHNSQKQSLELTSDLSILQMSRKELENQVGSLKEQHLRDSADLKTLLSKAENQAKDVQKEYEKTQTVLSELKLKFEMTEQ
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (1:200-1:500)
    Western Blot (1:100-1:250)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot
  • Western Blot
  • Western blot analysis of Lane 1: RT-4, Lane2: U-251MG sp, Lane 3: Human cell line A-431 with SLMAP polyclonal antibody (Cat # PAB28662).
  • Immunohistochemistry
  • Immunohistochemistry
  • Immunohistochemical staining of human smooth muscle with SLMAP polyclonal antibody (Cat # PAB28662) shows strong cytoplasmic positivity in smooth muscle cells.
  • Application Image
  • Gene Information
  • Entrez GeneID:
  • 7871
  • Gene Name:
  • SLMAP
  • Gene Alias:
  • FLJ42206,KIAA1601,MGC138760,MGC138761,SLAP
  • Gene Description:
  • sarcolemma associated protein
  • Other Designations:
  • OTTHUMP00000165233,Sarcolemmal-associated protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook