Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TOMM22 polyclonal antibody

  • Catalog # : PAB28636
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant TOMM22.
  • Immunogen:
  • Recombinant protein corresponding to amino acids of human TOMM22.
  • Sequence:
  • MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQK
  • Host:
  • Rabbit
  • Reactivity:
  • Human, Mouse, Rat
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (1:200-1:500)
    Western Blot (1:100-1:250)
    Immunofluorescence (1-4 ug/ml)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western blot analysis of Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells), Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) with TOMM22 polyclonal antibody (Cat # PAB28636) at 1:100-1:500 dilution.
  • Western Blot
  • Western Blot
  • Western blot analysis of Lane 1: Human cell line RT-4, Lane 2: Human cell line U-251MG sp with TOMM22 polyclonal antibody (Cat # PAB28636) at 1:100-1:250 dilution.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining of human kidney with TOMM22 polyclonal antibody (Cat # PAB28636) shows strong cytoplasmic positivity in renal tubules at 1:200-1:500 dilution.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of human cell line A-431 with TOMM22 polyclonal antibody (Cat # PAB28636) at 1-4 ug/ml shows positivity in mitochondria.
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Gene Name:
  • TOMM22
  • Gene Alias:
  • 1C9-2,MST065,MSTP065,TOM22
  • Gene Description:
  • translocase of outer mitochondrial membrane 22 homolog (yeast)
  • Gene Summary:
  • The protein encoded by this gene is an integral membrane protein of the mitochondrial outer membrane. The encoded protein interacts with TOMM20 and TOMM40, and forms a complex with several other proteins to import cytosolic preproteins into the mitochondrion. [provided by RefSeq
  • Other Designations:
  • mitochondrial import receptor Tom22
  • RSS
  • YouTube
  • Linkedin
  • Facebook