PSMD10 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western blot analysis of Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells), Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells), Lane 3: PC12 cell lysate (Pheochromocytoma of rat adrenal medulla) with PSMD10 polyclonal antibody (Cat # PAB28611) at 1:100-1:500 dilution.
Western Blot
Western blot analysis of Lane 1: Human cell line RT-4, Lane 2: Human cell line U-251MG sp, Lane 3: Human plasma (IgG/HSA depleted), Lane 4: Human liver tissue, Lane 5: Human tonsil tissue with PSMD10 polyclonal antibody (Cat # PAB28611) at 1:250-1:500 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human testis with PSMD10 polyclonal antibody (Cat # PAB28611) shows moderate cytoplasmic and nuclear positivity in cells of seminiferus ducts at 1:500-1:1000 dilution.
Immunofluorescence
Immunofluorescent staining of human cell line A-431 with PSMD10 polyclonal antibody (Cat # PAB28611) at 1-4 ug/ml shows positivity in cytoplasm.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant PSMD10.
Immunogen
Recombinant protein corresponding to amino acids of human PSMD10.
Sequence
EGCVSNLMVCNLAYSGKLEELKESILADKSLATRTDQDSRTALHWACSAGHTEIVEFLLQLGVPVNDKDDAGWSPLHIAASAGRDEIVKALLGKGAQVNAVNQNGCTPL
Host
Rabbit
Reactivity
Human, Mouse, Rat
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western blot analysis of Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells), Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells), Lane 3: PC12 cell lysate (Pheochromocytoma of rat adrenal medulla) with PSMD10 polyclonal antibody (Cat # PAB28611) at 1:100-1:500 dilution.Western Blot
Western blot analysis of Lane 1: Human cell line RT-4, Lane 2: Human cell line U-251MG sp, Lane 3: Human plasma (IgG/HSA depleted), Lane 4: Human liver tissue, Lane 5: Human tonsil tissue with PSMD10 polyclonal antibody (Cat # PAB28611) at 1:250-1:500 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human testis with PSMD10 polyclonal antibody (Cat # PAB28611) shows moderate cytoplasmic and nuclear positivity in cells of seminiferus ducts at 1:500-1:1000 dilution.Immunofluorescence
Immunofluorescent staining of human cell line A-431 with PSMD10 polyclonal antibody (Cat # PAB28611) at 1-4 ug/ml shows positivity in cytoplasm. -
Gene Info — PSMD10
Entrez GeneID
5716Protein Accession#
O75832Gene Name
PSMD10
Gene Alias
dJ889N15.2, p28
Gene Description
proteasome (prosome, macropain) 26S subunit, non-ATPase, 10
Omim ID
603480Gene Ontology
HyperlinkGene Summary
The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a non-ATPase subunit of the 19S regulator. Two transcripts encoding different isoforms have been described. Pseudogenes have been identified on chromosomes 3 and 20. [provided by RefSeq
Other Designations
26S proteasome non-ATPase regulatory subunit 10|26S proteasome regulatory subunit p28|OTTHUMP00000023827|OTTHUMP00000023828|ankyrin repeat protein|gankyrin|hepatocellular carcinoma-associated protein p28-II|proteasome 26S non-ATPase subunit 10
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com