Product Browser

Last updated: 2017/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

APEX1 polyclonal antibody

  • Catalog # : PAB28591
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant APEX1.
  • Immunogen:
  • Recombinant protein corresponding to amino acids of human APEX1.
  • Sequence:
  • KLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLAD
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Western Blot (1:100-1:250)
    Immunofluorescence (1-4 ug/ml)
    Immunohistochemistry (1:200-1:500)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot
  • Western Blot
  • Western blot analysis of Lane 1: Human cell line RT-4; Lane 2: Human cell line U-251MG sp; Lane 3: Human cell line A-431; Lane 4: Human liver tissue; Lane 6: Human tonsil tissue with APEX1 polyclonal antibody (Cat#PAB28591) at 1:100-1:250 dilution.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining of human small intestine with APEX1 polyclonal antibody (Cat#PAB28591) shows strong nuclear positivity in glandular cells at 1:200-1:500 dilution.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of human cell line U-2 OS with APEX1 polyclonal antibody (Cat#PAB28591) at 4 ug/ml shows positivity in nucleus.
  • Application Image
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 328
  • Gene Name:
  • APEX1
  • Gene Alias:
  • APE,APE-1,APE1,APEN,APEX,APX,HAP1,REF-1,REF1
  • Gene Description:
  • APEX nuclease (multifunctional DNA repair enzyme) 1
  • Gene Summary:
  • Apurinic/apyrimidinic (AP) sites occur frequently in DNA molecules by spontaneous hydrolysis, by DNA damaging agents or by DNA glycosylases that remove specific abnormal bases. AP sites are pre-mutagenic lesions that can prevent normal DNA replication so the cell contains systems to identify and repair such sites. Class II AP endonucleases cleave the phosphodiester backbone 5' to the AP site. This gene encodes the major AP endonuclease in human cells. Splice variants have been found for this gene; all encode the same protein. [provided by RefSeq
  • Other Designations:
  • AP endonuclease class I,AP lyase,APEX nuclease,DNA-(apurinic or apyrimidinic site) lyase,OTTHUMP00000163988,apurinic/apyrimidinic (abasic) endonuclease,apurinic/apyrimidinic exonuclease,deoxyribonuclease (apurinic or apyrimidinic),multifunctional DNA repa
  • Gene Pathway
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook