Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HUWE1 polyclonal antibody

  • Catalog # : PAB28584
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant HUWE1.
  • Immunogen:
  • Recombinant protein corresponding to amino acids of human HUWE1.
  • Sequence:
  • SGSSTTRLTQGIGRSQRTLRQLTANTGHTIHVHYPGNRQPNPPLILQRLLGPSAAADILQLSSSLPLQSRGRARLLVGNDDVHIIARSDDELLDDFFHDQSTATSQAGTLSSIPTALTRWTEECKVLDAESMHDCVSVVKVSIVNHLE
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunofluorescence (1-4 ug/ml)
    Immunohistochemistry (1:50-1:200)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining of human testis with HUWE1 polyclonal antibody (Cat#PAB28584) shows strong nuclear and cytoplasmic positivity in cells of seminiferus ducts.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of human cell line U-251MG with HUWE1 polyclonal antibody (Cat#PAB28584) at 4 ug/ml shows positivity in nucleus but not nucleoli and cytoplasm.
  • Application Image
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Gene Name:
  • HUWE1
  • Gene Alias:
  • ARF-BP1,HECTH9,HSPC272,Ib772,KIAA0312,LASU1,MULE,UREB1
  • Gene Description:
  • HECT, UBA and WWE domain containing 1
  • Other Designations:
  • ARF binding protein 1,BJ-HCC-24 tumor antigen,HECT domain protein LASU1,Mcl-1 ubiquitin ligase E3,OTTHUMP00000023356,OTTHUMP00000061860
  • RSS
  • YouTube
  • Linkedin
  • Facebook