ALDOB polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
Western blot analysis of human liver using ALDOB polyclonal antibody (Cat # PAB28579).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) of human liver with ALDOB polyclonal antibody (Cat # PAB28579) shows strong cytoplasmic and nuclear positivity in hepatocytes.
Immunofluorescence
Immunofluorescence of A-431 cell line with ALDOB polyclonal antibody (Cat # PAB28579) shows positivity in nuclei but not nucleoli. Fixation/Permeabilization: PFA/Triton X-106
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant ALDOB.
Immunogen
Recombinant protein corresponding to human ALDOB.
Sequence
KPNMVTAGHACTKKYTPEQVAMATVTALHRTVPAAVPGICFLSGGMSEEDATLNLNAINLCPLPKPWKLSFSYGRALQASALAAWGGKAANKEATQEAFMKRAMANCQAAKGQYVHTGSSGAA
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Western Blot (1:250)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:750)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Tissue lysate)
Western blot analysis of human liver using ALDOB polyclonal antibody (Cat # PAB28579).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) of human liver with ALDOB polyclonal antibody (Cat # PAB28579) shows strong cytoplasmic and nuclear positivity in hepatocytes.Immunofluorescence
Immunofluorescence of A-431 cell line with ALDOB polyclonal antibody (Cat # PAB28579) shows positivity in nuclei but not nucleoli. Fixation/Permeabilization: PFA/Triton X-106 -
Gene Info — ALDOB
Entrez GeneID
229Protein Accession#
P05062Gene Name
ALDOB
Gene Alias
-
Gene Description
aldolase B, fructose-bisphosphate
Omim ID
229600Gene Ontology
HyperlinkGene Summary
Fructose-1,6-bisphosphate aldolase (EC 4.1.2.13) is a tetrameric glycolytic enzyme that catalyzes the reversible conversion of fructose-1,6-bisphosphate to glyceraldehyde 3-phosphate and dihydroxyacetone phosphate. Vertebrates have 3 aldolase isozymes which are distinguished by their electrophoretic and catalytic properties. Differences indicate that aldolases A, B, and C are distinct proteins, the products of a family of related 'housekeeping' genes exhibiting developmentally regulated expression of the different isozymes. The developing embryo produces aldolase A, which is produced in even greater amounts in adult muscle where it can be as much as 5% of total cellular protein. In adult liver, kidney and intestine, aldolase A expression is repressed and aldolase B is produced. In brain and other nervous tissue, aldolase A and C are expressed about equally. There is a high degree of homology between aldolase A and C. Defects in ALDOB cause hereditary fructose intolerance. [provided by RefSeq
Other Designations
OTTHUMP00000021803|aldolase 2|aldolase B, fructose-bisphosphatase
-
Interactome
-
Pathway
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of alkaloids derived from ornithine
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of alkaloids derived from terpenoid and polyketide
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Biosynthesis of terpenoids and steroids
- Carbon fixation in photosynthetic organisms
- Fructose and mannose metabolism
+ View More Disease
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com