Product Browser

Last updated: 2017/1/22

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PSMD14 polyclonal antibody

  • Catalog # : PAB28572
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant PSMD14.
  • Immunogen:
  • Recombinant protein corresponding to human PSMD14.
  • Sequence:
  • AVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVRVIDVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALSERAVAVVVDPIQSVKGKVVIDA
  • Host:
  • Rabbit
  • Reactivity:
  • Human, Mouse, Rat
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Western Blot (Human: 1:100-1:250, Mouse/Rat: 1:100-1:500)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
    Immunofluorescence (1-4 ug/ml)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western blot analysis of lane 1: NIH-3T3 and lane 2: NBT-II cell lysates using PSMD14 polyclonal antibody (Cat # PAB28572).
  • Western Blot
  • Western Blot
  • Western blot analysis of lane 1: RT-4, lane 2: U-251 MG, lane 3: Liver and lane 4: Tonsil using PSMD14 polyclonal antibody (Cat # PAB28572).
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) of human hippocampus with PSMD14 polyclonal antibody (Cat # PAB28572) shows strong nuclear positivity in neuronal cells. Retrieval method: HIER pH6
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescence of U-2 OS cell line with PSMD14 polyclonal antibody (Cat # PAB28572) shows positivity in nucleus but not nucleoli and vesicles. Fixation/Permeabilization: PFA/Triton X-102
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Gene Name:
  • PSMD14
  • Gene Alias:
  • PAD1,POH1,rpn11
  • Gene Description:
  • proteasome (prosome, macropain) 26S subunit, non-ATPase, 14
  • Gene Summary:
  • PSMD14 is a component of the 26S proteasome, a multiprotein complex that degrades proteins targeted for destruction by the ubiquitin pathway (Spataro et al., 1997 [PubMed 9374539]).[supplied by OMIM
  • Other Designations:
  • 26S proteasome-associated pad1 homolog
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook