PSMD14 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western blot analysis of lane 1: NIH-3T3 and lane 2: NBT-II cell lysates using PSMD14 polyclonal antibody (Cat # PAB28572).
Western Blot
Western blot analysis of lane 1: RT-4, lane 2: U-251 MG, lane 3: Liver and lane 4: Tonsil using PSMD14 polyclonal antibody (Cat # PAB28572).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) of human hippocampus with PSMD14 polyclonal antibody (Cat # PAB28572) shows strong nuclear positivity in neuronal cells. Retrieval method: HIER pH6
Immunofluorescence
Immunofluorescence of U-2 OS cell line with PSMD14 polyclonal antibody (Cat # PAB28572) shows positivity in nucleus but not nucleoli and vesicles. Fixation/Permeabilization: PFA/Triton X-102
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant PSMD14.
Immunogen
Recombinant protein corresponding to human PSMD14.
Sequence
AVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVRVIDVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALSERAVAVVVDPIQSVKGKVVIDA
Host
Rabbit
Reactivity
Human, Mouse, Rat
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Western Blot (Human: 1:100-1:250, Mouse/Rat: 1:100-1:500)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western blot analysis of lane 1: NIH-3T3 and lane 2: NBT-II cell lysates using PSMD14 polyclonal antibody (Cat # PAB28572).Western Blot
Western blot analysis of lane 1: RT-4, lane 2: U-251 MG, lane 3: Liver and lane 4: Tonsil using PSMD14 polyclonal antibody (Cat # PAB28572).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) of human hippocampus with PSMD14 polyclonal antibody (Cat # PAB28572) shows strong nuclear positivity in neuronal cells. Retrieval method: HIER pH6Immunofluorescence
Immunofluorescence of U-2 OS cell line with PSMD14 polyclonal antibody (Cat # PAB28572) shows positivity in nucleus but not nucleoli and vesicles. Fixation/Permeabilization: PFA/Triton X-102 -
Gene Info — PSMD14
Entrez GeneID
10213Protein Accession#
O00487Gene Name
PSMD14
Gene Alias
PAD1, POH1, rpn11
Gene Description
proteasome (prosome, macropain) 26S subunit, non-ATPase, 14
Omim ID
607173Gene Ontology
HyperlinkGene Summary
PSMD14 is a component of the 26S proteasome, a multiprotein complex that degrades proteins targeted for destruction by the ubiquitin pathway (Spataro et al., 1997 [PubMed 9374539]).[supplied by OMIM
Other Designations
26S proteasome-associated pad1 homolog
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com