Product Browser

Last updated: 2017/5/21

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

KDM6A polyclonal antibody

  • Catalog # : PAB28570
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant KDM6A.
  • Immunogen:
  • Recombinant protein corresponding to human KDM6A.
  • Sequence:
  • IGNNHITGSGSNGNVPYLQRNALTLPHNRTNLTSSAEEPWKNQLSNSTQGLHKGQSSHSAGPNGERPLSSTGPSQHLQAAGSGIQNQNGHPTLPSNSVTQGAALNHLSSHTATSGGQQGITLTKESKPSGNILTVPETSRHT
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) of human duodenum with KDM6A polyclonal antibody (Cat # PAB28570) shows strong nuclear positivity in glandular cells. Retrieval method: HIER pH6
  • Application Image
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 7403
  • Gene Name:
  • KDM6A
  • Gene Alias:
  • UTX,KABUK2,bA386N14.2
  • Gene Description:
  • lysine (K)-specific demethylase 6A
  • Other Designations:
  • OTTHUMP00000023175,OTTHUMP00000061534,bA386N14.2 (ubiquitously transcribed X chromosome tetratricopeptide repeat protein (UTX)),ubiquitously transcribed tetratricopeptide repeat gene, X chromosome,ubiquitously-transcribed TPR gene on the X chromosome
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook