Product Browser

Last updated: 2017/7/16

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HNF1B polyclonal antibody

  • Catalog # : PAB28567
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant HNF1B.
  • Immunogen:
  • Recombinant protein corresponding to human HNF1B.
  • Sequence:
  • KEVLVQALEELLPSPNFGVKLETLPLSPGSGAEPDTKPVFHTLTNGHAKGRLSGDEGSEDGDDYDTPPILKELQALNTEEAAEQRAEVDRMLSEDPWRAAKMIKGYMQQH
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Western Blot (1:250-1:500)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
    Immunofluorescence (1-4 ug/ml)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western blot analysis of HEK293T cell lysate using HNF1B polyclonal antibody (Cat # PAB28567).
    Lane 1: Negative control (vector only)
    Lane 2: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa)
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescence of U-251 MG cell line with HNF1B polyclonal antibody (Cat # PAB28567) shows positivity in nucleus but not nucleoli. Fixation/Permeabilization: PFA/Triton X-100
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 6928
  • Gene Name:
  • HNF1B
  • Gene Alias:
  • FJHN,HNF1beta,HNF2,HPC11,LF-B3,LFB3,MODY5,TCF2,VHNF1
  • Gene Description:
  • HNF1 homeobox B
  • Gene Summary:
  • This gene encodes a member of the homeodomain-containing superfamily of transcription factors. The protein binds to DNA as either a homodimer, or a heterodimer with the related protein hepatocyte nuclear factor 1-alpha. The gene has been shown to function in nephron development, and regulates development of the embryonic pancreas. Mutations in this gene result in renal cysts and diabetes syndrome and noninsulin-dependent diabetes mellitus, and expression of this gene is altered in some types of cancer. Multiple transcript variants encoding different isoforms have been found for this gene
  • Other Designations:
  • transcription factor 2,transcription factor 2, hepatic,transcription factor 2, hepatic; LF-B3; variant hepatic nuclear factor
  • RSS
  • YouTube
  • Linkedin
  • Facebook