Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NCF2 polyclonal antibody

  • Catalog # : PAB28551
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant NCF2.
  • Immunogen:
  • Recombinant protein corresponding to amino acids of recombinant NCF2.
  • Sequence:
  • QEESSPQSDIPAPPSSKAPGRPQLSPGQKQKEEPKEVKLSVPMPYTLKVHYKYTVVMKTQPGLPYSQVRDMVSKKLELRLEHTKLSYRPRDSNELVPLSEDSMKDAWGQVKNYCLTLWCENTVGDQGFPDEPKESEKADANNQTTEPQ
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry(1:200-1:500)
    Western Blot(1:100-1:250)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot
  • Western Blot
  • Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: A-431, Lane 4: Liver, Lane 5: Tonsil with NCF2 polyclonal antibody (PAB28551).
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining of human bone marrow with NCF2 polyclonal antibody (Cat # PAB28551) shows strong cytoplasmic positivity in bone marrow poietic cells.
  • Application Image
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 4688
  • Gene Name:
  • NCF2
  • Gene Alias:
  • FLJ93058,NCF-2,NOXA2,P67-PHOX,P67PHOX
  • Gene Description:
  • neutrophil cytosolic factor 2
  • Gene Summary:
  • This gene encodes neutrophil cytosolic factor 2, the 67-kilodalton cytosolic subunit of the multi-protein NADPH oxidase complex found in neutrophils. This oxidase produces a burst of superoxide which is delivered to the lumen of the neutrophil phagosome. Mutations in this gene, as well as in other NADPH oxidase subunits, can result in chronic granulomatous disease, a disease that causes recurrent infections by catalase-positive organisms. Alternative splicing results in two transcript variants that encode the same protein. [provided by RefSeq
  • Other Designations:
  • 67 kDa neutrophil oxidase factor,NADPH oxidase activator 2,OTTHUMP00000033269,OTTHUMP00000033270,chronic granulomatous disease, autosomal 2,neutrophil cytosol factor 2,neutrophil cytosolic factor 2 (65kD, chronic granulomatous disease, autosomal 2)
  • RSS
  • YouTube
  • Linkedin
  • Facebook