Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GOLIM4 polyclonal antibody

  • Catalog # : PAB28549
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant GOLIM4.
  • Immunogen:
  • Recombinant protein corresponding to amino acids of recombinant GOLIM4.
  • Sequence:
  • ENRQLRKAHQDIHTQLQDVKQQHKNLLSEHEQLVVTLEDHKSALAAAQTQVAEYKQLKDTLNRIPSLRKPDPAEQQNVTQVAHSPQGYNTAREKPTREVQEVSRNNDVWQ
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry(1:50-1:200)
    Immunofluorescence (1-4 ug/ml)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining of human liver with GOLIM4 polyclonal antibody (Cat # PAB28549) shows strong cytoplasmic positivity with granular pattern in hepatocytes.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of U373 MG with GOLIM4 polyclonal antibody (Cat # PAB28549) at 1-4 ug/mL dilution shows positivity in nucleus but not nucleoli & golgi apparatus.
  • Application Image
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Gene Name:
  • GOLIM4
  • Gene Alias:
  • GIMPC,GOLPH4,GPP130,P138
  • Gene Description:
  • golgi integral membrane protein 4
  • Gene Summary:
  • The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a type II Golgi-resident protein. It may process proteins synthesized in the rough endoplasmic reticulum and assist in the transport of protein cargo through the Golgi apparatus. [provided by RefSeq
  • Other Designations:
  • 130 kDa golgi-localized phosphoprotein,cis Golgi-localized calcium-binding protein,golgi phosphoprotein 4,type II Golgi membrane protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook