IDH3G polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant IDH3G.
Immunogen
Recombinant protein corresponding to amino acids of human IDH3G.
Sequence
ADEEDIRNAIMAIRRNRVALKGNIETNHNLPPSHKSRNNILRTSLDLYANVIHCKSLPGVVTRHKDIDILIVRENTEGEYSSLEHESVAGVVESLKIITKAKSLRIAEYAFKLAQESGRKKVTAVHKANIMKLGDGLFLQCCREVAA
Host
Rabbit
Reactivity
Human, Mouse, Rat
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Western Blot (1:100-1:500)
Immunofluorescence (1-4 ug/ml)
Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western blot analysis of Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells), Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells), Lane 3: PC12 cell lysate (Pheochromocytoma of rat adrenal medulla) with IDH3G polyclonal antibody (Cat # PAB28538) at 1:100-1:500 dilution.Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: EFO-21, Lane 3: A-431, Lane 4: Liver, Lane 5: Tonsil with IDH3G polyclonal antibody (Cat # PAB28538) at 1:250-1:500 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human IDH3G polyclonal antibody (Cat # PAB28538) shows strong cytoplasmic positivity in cortical cells at 1:50-1:200 dilution.Immunofluorescence
Immunofluorescent staining of human cell line U-2 OS with IDH3G polyclonal antibody (Cat # PAB28538) at 1-4 ug/ml shows positivity in nucleoli and mitochondria. -
Gene Info — IDH3G
Entrez GeneID
3421Protein Accession#
E7EQB8Gene Name
IDH3G
Gene Alias
H-IDHG
Gene Description
isocitrate dehydrogenase 3 (NAD+) gamma
Omim ID
300089Gene Ontology
HyperlinkGene Summary
Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. NAD(+)-dependent isocitrate dehydrogenases catalyze the allosterically regulated rate-limiting step of the tricarboxylic acid cycle. Each isozyme is a heterotetramer that is composed of two alpha subunits, one beta subunit, and one gamma subunit. The protein encoded by this gene is the gamma subunit of one isozyme of NAD(+)-dependent isocitrate dehydrogenase. This gene is a candidate gene for periventricular heterotopia. Several alternatively spliced transcript variants of this gene have been described, but only some of their full length natures have been determined. [provided by RefSeq
Other Designations
IDH-gamma|NAD (H)-specific isocitrate dehydrogenase gamma subunit|NAD+-specific ICDH|OTTHUMP00000025985|isocitrate dehydrogenase, NAD(+)-specific, mitochondrial, gamma subunit|isocitric dehydrogenase
-
Interactome
-
Pathway
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of alkaloids derived from ornithine
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of alkaloids derived from terpenoid and polyketide
- Biosynthesis of plant hormones
- Biosynthesis of terpenoids and steroids
- Citrate cycle (TCA cycle)
- Metabolic pathways
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com