INTS6 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: A-431, Lane 4: Liver, Lane 5: Tonsil with INTS6 polyclonal antibody at 1:250 - 1:500 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human testis with INTS6 polyclonal antibody (Cat # PAB28493) shows cytoplasmic positivity in trophoblastic cells at 1:50-1:200 dilution.
Immunofluorescence
Immunofluorescent staining of human cell line U-251MG with INTS6 polyclonal antibody (Cat # PAB28493) at 1-4 ug/ml shows positivity in nucleus but not nucleoli.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant INTS6.
Immunogen
Recombinant protein corresponding to amino acids of human INTS6
Sequence
VVNNHIGGKGPPAPTTQAQPDLIKPLPLHKISETTNDSIIHDVVENHVADQLSSDITPNAMDTEFSASSPASLLERPTNHMEALGHDHLGTNDLTVGGFLENHEEPRDKEQCAEENIPASSLNKGKKLMHCRSHEEVNTELKAQ
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry(1:50-1:200)
Western Blot(1:250 - 1:500)
Immunofluorescence(1-4 ug/ml)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: A-431, Lane 4: Liver, Lane 5: Tonsil with INTS6 polyclonal antibody at 1:250 - 1:500 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human testis with INTS6 polyclonal antibody (Cat # PAB28493) shows cytoplasmic positivity in trophoblastic cells at 1:50-1:200 dilution.Immunofluorescence
Immunofluorescent staining of human cell line U-251MG with INTS6 polyclonal antibody (Cat # PAB28493) at 1-4 ug/ml shows positivity in nucleus but not nucleoli. -
Gene Info — INTS6
Entrez GeneID
26512Protein Accession#
B3KQH5Gene Name
INTS6
Gene Alias
DBI-1, DDX26, DDX26A, DICE1, DKFZp434B105, HDB, INT6, Notchl2
Gene Description
integrator complex subunit 6
Omim ID
604331Gene Ontology
HyperlinkGene Summary
DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. The protein encoded by this gene is a DEAD box protein that is part of a complex that interacts with the C-terminus of RNA polymerase II and is involved in 3' end processing of snRNAs. In addition, this gene is a candidate tumor suppressor and located in the critical region of loss of heterozygosity (LOH). Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq
Other Designations
DEAD box protein|DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 26|OTTHUMP00000040879|RNA helicase HDB
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com