SOX9 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western blot analysis of Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells), Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells), Lane 3: PC12 cell lysate (Pheochromocytoma of rat adrenal medulla) with SOX9 polyclonal antibody at 1:100-1:500 dilution.
Western Blot (Transfected lysate)
Western blot analysis of Lane 1: Negative control (vector only transfected HEK293T lysate), Lane 2: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells) with SOX9 polyclonal antibody at 1:100-1:250 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human testis with SOX9 polyclonal antibody (Cat # PAB28483) shows distinct nuclear positivity in cells in seminiferus ducts at 1:200-1:500 dilution.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant SOX9.
Immunogen
Recombinant protein corresponding to amino acids of human SOX9
Sequence
SQRTHIKTEQLSPSHYSEQQQHSPQQIAYSPFNLPHYSPSYPPITRSQYDYTDHQNSSSYYSHAAGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQLTR
Host
Rabbit
Reactivity
Human, Mouse, Rat
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry(1:200-1:500)
Western Blot(1:100-1:500)
Immunofluorescence(1-4 ug/ml)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western blot analysis of Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells), Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells), Lane 3: PC12 cell lysate (Pheochromocytoma of rat adrenal medulla) with SOX9 polyclonal antibody at 1:100-1:500 dilution.Western Blot (Transfected lysate)
Western blot analysis of Lane 1: Negative control (vector only transfected HEK293T lysate), Lane 2: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells) with SOX9 polyclonal antibody at 1:100-1:250 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human testis with SOX9 polyclonal antibody (Cat # PAB28483) shows distinct nuclear positivity in cells in seminiferus ducts at 1:200-1:500 dilution. -
Gene Info — SOX9
Entrez GeneID
6662Protein Accession#
P48436Gene Name
SOX9
Gene Alias
CMD1, CMPD1, SRA1
Gene Description
SRY (sex determining region Y)-box 9
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene recognizes the sequence CCTTGAG along with other members of the HMG-box class DNA-binding proteins. It acts during chondrocyte differentiation and, with steroidogenic factor 1, regulates transcription of the anti-Muellerian hormone (AMH) gene. Deficiencies lead to the skeletal malformation syndrome campomelic dysplasia, frequently with sex reversal. [provided by RefSeq
Other Designations
SRY (sex determining region Y)-box 9 (campomelic dysplasia, autosomal sex-reversal)|SRY (sex-determining region Y)-box 9 (campomelic dysplasia, autosomal sex-reversal)|SRY (sex-determining region Y)-box 9 protein|campomelic dysplasia, autosomal sex-revers
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com