GOLIM4 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant GOLIM4.
Immunogen
Recombinant protein corresponding to amino acids of human GOLIM4
Sequence
EHLEEEHDPSPEEQDREWKEQHEQREAANLLEGHARAEVYPSAKPMIKFQSPYEEQLEQQRLAVQQVEEAQQLREHQEALHQQRLQGHLLRQQEQQQQQVAREMALQRQAELEEGRPQHQEQLRQQAHYDAMDNDIVQGAED
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry(1:200-1:500)
Immunofluorescence(1-4 ug/ml)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human duodenum with GOLIM4 polyclonal antibody (Cat # PAB28477) shows strong cytoplasmic positivity in glandular cells.Immunofluorescence
Immunofluorescent staining of human cell line U-2 OS with GOLIM4 polyclonal antibody (Cat # PAB28477) at 1-4 ug/ml shows positivity in golgi. -
Gene Info — GOLIM4
Entrez GeneID
27333Protein Accession#
F8W785Gene Name
GOLIM4
Gene Alias
GIMPC, GOLPH4, GPP130, P138
Gene Description
golgi integral membrane protein 4
Omim ID
606805Gene Ontology
HyperlinkGene Summary
The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a type II Golgi-resident protein. It may process proteins synthesized in the rough endoplasmic reticulum and assist in the transport of protein cargo through the Golgi apparatus. [provided by RefSeq
Other Designations
130 kDa golgi-localized phosphoprotein|cis Golgi-localized calcium-binding protein|golgi phosphoprotein 4|type II Golgi membrane protein
-
Interactome
-
Publication Reference
-
ER ribosomal-binding protein 1 regulates blood pressure and potassium homeostasis by modulating intracellular renin trafficking.
Chu-Hsuan Chiu, Chin-Feng Hsuan, Shih-Hua Lin, Yi-Jen Hung, Chii-Min Hwu, Siow-Wey Hee,Shu-Wha Lin, Sitt-Wai Fong, Patrick Ching-Ho Hsieh, Wei-Shun Yang, Wei-Chou Lin, Hsiao-Lin Lee, Meng-Lun Hsieh, Wen-Yi Li, Jou-Wei Lin, Chih-Neng Hsu, Vin-Cent Wu, Gwo-Tsann Chuang, Yi-Cheng Chang and Lee-Ming Chuang.
Journal of Biomedical Science 2023 Feb; 30:13.
Application:IF-Tr, Human, Calu-6 cells.
-
CircRNA RNF10 inhibits tumorigenicity by targeting miR-942-5p/GOLIM4 axis in breast cancer.
Binghua Kan, Guiru Yan, Yuan Shao, Ziliang Zhang, Hui Xue.
Environmental and Molecular Mutagenesis 2022 Aug; 63(7):362.
Application:WB, Human, Human breast cancer tissue.
-
RBFOX2/GOLIM4 Splicing Axis Activates Vesicular Transport Pathway to Promote Nasopharyngeal Carcinogenesis.
Chun-Ling Luo, Xiao-Chen Xu, Chu-Jun Liu, Shuai He, Jie-Rong Chen, Yan-Chun Feng, Shu-Qiang Liu, Wan Peng, Ya-Qing Zhou, Yu-Xiang Liu, Pan-Pan Wei, Bo Li, Hai-Qiang Mai, Xiao-Jun Xia, Jin-Xin Bei.
Advanced Science (Weinheim, Baden-Württemberg, Germany) 2021 Aug; 8(16):e2004852.
Application:IF, WB-Tr, Human, 5-8F, S26 cells.
-
Golgi integral membrane protein 4 manipulates cellular proliferation, apoptosis and cell cycle in human head and neck cancer.
Cui X, Gao D, Bai Y, Wang Y, Wang B, Wang W.
Bioscience Reports 2018 Aug; 38(4):BSR2018045.
Application:WB-Tr, Human, FaDu, Tca-8113 cells.
-
ER ribosomal-binding protein 1 regulates blood pressure and potassium homeostasis by modulating intracellular renin trafficking.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com