Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RBM22 polyclonal antibody

  • Catalog # : PAB28467
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant RBM22
  • Immunogen:
  • Recombinant protein corresponding to amino acids of human RBM22
  • Sequence:
  • NTYNRQNWEDADFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPGVRMRFKKTEVCQTCSKLKNVCQTCLLDLEYGLPIQVRDAGLSFKDDMPKSDVNKEYYTQNMEREISNSDGTRPVGMLGKATSTSDMLLKL
  • Host:
  • Rabbit
  • Reactivity:
  • Human, Mouse, Rat
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry(1:20-1:50)
    Western Blot(1:100-1:250)
    Immunofluorescence(1-4 ug/ml)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western blot analysis of Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells), Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells), Lane 3: PC12 cell lysate (Pheochromocytoma of rat adrenal medulla) with RBM22 polyclonal antibody at 1:100-1:500 dilution.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining of human cerebral cortex with RBM22 polyclonal antibody (Cat # PAB28467) shows strong nuclear positivity in neuronal cells at 1:20-1:50 dilution.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of human cell line U-251MG with RBM22 polyclonal antibody (Cat # PAB28467) at 1-4 ug/ml shows positivity in nuclei but not nucleoli.
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Gene Name:
  • RBM22
  • Gene Alias:
  • FLJ10290,ZC3H16,fSAP47
  • Gene Description:
  • RNA binding motif protein 22
  • Gene Summary:
  • This gene encodes an RNA binding protein. The encoded protein may play a role in cell division and may be involved in pre-mRNA splicing. Related pseudogenes exist on chromosomes 6, 7, 9, 13, 16, 18, and X. [provided by RefSeq
  • Other Designations:
  • functional spliceosome-associated protein 47
  • RSS
  • YouTube
  • Linkedin
  • Facebook