RBM39 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: EFO-21, Lane 3: A-431, Lane 4: Liver, Lane 5: Tonsil with RBM39 polyclonal antibody (Cat # PAB28454) at 1:100-1:250 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human colon with RBM39 polyclonal antibody (Cat # PAB28454) shows nuclear positivity in glandular cells at 1:50-1:200 dilution.
Immunofluorescence
Immunofluorescent staining of U-2 OS with RBM39 polyclonal antibody (Cat # PAB28454) at 1-4 ug/mL dilution shows positivity in nucleus but not nucleoli & cytoskeleton (microtubules).
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant RBM39.
Immunogen
Recombinant protein corresponding to amino acids of recombinant RBM39.
Sequence
LAAAASVQPLATQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQGNVYVKCPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPDSMTATQ
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry( 1:50-1:200)
Western Blot(1:100-1:250)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: EFO-21, Lane 3: A-431, Lane 4: Liver, Lane 5: Tonsil with RBM39 polyclonal antibody (Cat # PAB28454) at 1:100-1:250 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human colon with RBM39 polyclonal antibody (Cat # PAB28454) shows nuclear positivity in glandular cells at 1:50-1:200 dilution.Immunofluorescence
Immunofluorescent staining of U-2 OS with RBM39 polyclonal antibody (Cat # PAB28454) at 1-4 ug/mL dilution shows positivity in nucleus but not nucleoli & cytoskeleton (microtubules). -
Gene Info — RBM39
Entrez GeneID
9584Protein Accession#
E1P5S2Gene Name
RBM39
Gene Alias
CAPER, CAPERalpha, CC1.3, DKFZp781C0423, FLJ44170, HCC1, RNPC2, fSAP59
Gene Description
RNA binding motif protein 39
Omim ID
604739Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is an RNA binding protein and possible splicing factor. The encoded protein is found in the nucleus, where it colocalizes with core spliceosomal proteins. Studies of a mouse protein with high sequence similarity to this protein suggest that this protein may act as a transcriptional coactivator for JUN/AP-1 and estrogen receptors. Multiple transcript variants encoding different isoforms have been observed for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000030794|OTTHUMP00000030795|RNA-binding region (RNP1, RRM) containing 2|coactivator of activating protein-1 and estrogen receptors|functional spliceosome-associated protein 59|hepatocellular carcinoma protein 1|splicing factor CC1.3|splicing fac
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com