Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RBM39 polyclonal antibody

  • Catalog # : PAB28454
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant RBM39.
  • Immunogen:
  • Recombinant protein corresponding to amino acids of recombinant RBM39.
  • Sequence:
  • LAAAASVQPLATQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQGNVYVKCPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPDSMTATQ
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry( 1:50-1:200)
    Western Blot(1:100-1:250)
    Immunofluorescence (1-4 ug/ml)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot
  • Western Blot
  • Western blot analysis of Lane 1: RT-4, Lane 2: EFO-21, Lane 3: A-431, Lane 4: Liver, Lane 5: Tonsil with RBM39 polyclonal antibody (Cat # PAB28454) at 1:100-1:250 dilution.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining of human colon with RBM39 polyclonal antibody (Cat # PAB28454) shows nuclear positivity in glandular cells at 1:50-1:200 dilution.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of U-2 OS with RBM39 polyclonal antibody (Cat # PAB28454) at 1-4 ug/mL dilution shows positivity in nucleus but not nucleoli & cytoskeleton (microtubules).
  • Application Image
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 9584
  • Gene Name:
  • RBM39
  • Gene Alias:
  • CAPER,CAPERalpha,CC1.3,DKFZp781C0423,FLJ44170,HCC1,RNPC2,fSAP59
  • Gene Description:
  • RNA binding motif protein 39
  • Gene Summary:
  • The protein encoded by this gene is an RNA binding protein and possible splicing factor. The encoded protein is found in the nucleus, where it colocalizes with core spliceosomal proteins. Studies of a mouse protein with high sequence similarity to this protein suggest that this protein may act as a transcriptional coactivator for JUN/AP-1 and estrogen receptors. Multiple transcript variants encoding different isoforms have been observed for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000030794,OTTHUMP00000030795,RNA-binding region (RNP1, RRM) containing 2,coactivator of activating protein-1 and estrogen receptors,functional spliceosome-associated protein 59,hepatocellular carcinoma protein 1,splicing factor CC1.3,splicing fac
  • RSS
  • YouTube
  • Linkedin
  • Facebook