ATP5B polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: A-431, Lane 4: Liver, Lane 5: Tonsil with ATP5B polyclonal antibody (Cat # PAB28448) at 1:250-1:500 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human duodenum with ATP5B polyclonal antibody (Cat # PAB28448) shows strong cytoplasmic positivity in glandular cells at 1:500-1:1000 dilution.
Immunofluorescence
Immunofluorescent staining of U-2 OS with ATP5B polyclonal antibody (Cat # PAB28448) at 1-4 ug/mL dilution shows positivity in mitochondria.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant ATP5B.
Immunogen
Recombinant protein corresponding to amino acids of recombinant ATP5B.
Sequence
TSPSPKAGAATGRIVAVIGAVVDVQFDEGLPPILNALEVQGRETRLVLEVAQHLGESTVRTIAMDGTEGLVRGQKVLDSGAPIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFMEMSVEQEILVTGIKVVD
Host
Rabbit
Reactivity
Human, Mouse, Rat
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry(1:500-1:1000)
Western Blot(1:250-1:500)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: A-431, Lane 4: Liver, Lane 5: Tonsil with ATP5B polyclonal antibody (Cat # PAB28448) at 1:250-1:500 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human duodenum with ATP5B polyclonal antibody (Cat # PAB28448) shows strong cytoplasmic positivity in glandular cells at 1:500-1:1000 dilution.Immunofluorescence
Immunofluorescent staining of U-2 OS with ATP5B polyclonal antibody (Cat # PAB28448) at 1-4 ug/mL dilution shows positivity in mitochondria. -
Gene Info — ATP5B
Entrez GeneID
506Protein Accession#
F8VPV9Gene Name
ATP5B
Gene Alias
ATPMB, ATPSB, MGC5231
Gene Description
ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide
Omim ID
102910Gene Ontology
HyperlinkGene Summary
This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). This gene encodes the beta subunit of the catalytic core. [provided by RefSeq
Other Designations
ATP synthase, H+ transporting, mitochondrial F1 complex, beta subunit|mitochondrial ATP synthetase, beta subunit
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Identification of a mitochondrial targeting sequence in cathepsin D and its localization in mitochondria.
Naoki Ikari, Hirofumi Arakawa.
Biochemical and Biophysical Research Communications 2023 May; 655:25.
Application：WB-Ce, Human, HeLa, HKE 293T cells.
-
Identification of a mitochondrial targeting sequence in cathepsin D and its localization in mitochondria.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com