Product Browser

Last updated: 2017/2/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CHUK polyclonal antibody

  • Catalog # : PAB28431
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant CHUK.
  • Immunogen:
  • Recombinant protein corresponding to amino acids of recombinant CHUK.
  • Sequence:
  • HTVQSQDRVLKELFGHLSKLLGCKQKIIDLLPKVEVALSNIKEADNTVMFMQGKRQKEIWHLLKIACTQSSARSLVGSSLEGAVTPQTSAWLPPTSAEHDHSLSCVVTPQDGETSAQMIEENLNCLGHLSTIIHEANEEQGNSMMN
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry(1:200-1:500)
    Immunofluorescence (1-4 ug/ml)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining of human testis with CHUK polyclonal antibody (Cat # PAB28431) shows strong cytoplasmic positivity in cells of seminiferus ducts.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of A-431 with CHUK polyclonal antibody (Cat # PAB28431) at 1-4 ug/mL dilution shows positivity in nucleus but not nucleoli & cytoplasm.
  • Application Image
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 1147
  • Gene Name:
  • CHUK
  • Gene Alias:
  • IKBKA,IKK-alpha,IKK1,IKKA,NFKBIKA,TCF16
  • Gene Description:
  • conserved helix-loop-helix ubiquitous kinase
  • Gene Summary:
  • This gene encodes a member of the serine/threonine protein kinase family. The encoded protein, a component of a cytokine-activated protein complex that is an inhibitor of the essential transcription factor NF-kappa-B complex, phosphorylates sites that trigger the degradation of the inhibitor via the ubiquination pathway, thereby activating the transcription factor. [provided by RefSeq
  • Other Designations:
  • I-kappa-B kinase 1,I-kappa-B kinase-alpha,IKK-a kinase,IkB kinase alpha subunit,Nuclear factor NFkappaB inhibitor kinase alpha,OTTHUMP00000020273,conserved helix-loop ubiquitous kinase
  • Interactome
  • Interactome
  • RSS
  • YouTube
  • Linkedin
  • Facebook