Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FLOT1 polyclonal antibody

  • Catalog # : PAB28424
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant FLOT1.
  • Immunogen:
  • Recombinant protein corresponding to human FLOT1.
  • Sequence:
  • HQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQYLSEIEMAKAQRDYELKKAAYDIEVNTRRAQADLAYQLQVAKTKQQIEEQR
  • Host:
  • Rabbit
  • Reactivity:
  • Human, Mouse, Rat
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Western Blot (Human: 1:250-1:500, Rodent: 1:100-1:500)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000-1:2500)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4 °C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western blot analysis of lane 1: NIH-3T3 cell lysate and lane 2: NBT-II cell lysate using FLOT1 polyclonal antibody (Cat # PAB28424).
  • Western Blot
  • Western Blot
  • Western blot analysis of lane 1: RT-4, lane 2: U-251 MG, lane 3: A-431, lane 4: Liver and lane 5: Tonsil using FLOT1 polyclonal antibody (Cat # PAB28424).
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) of human stomach with FLOT1 polyclonal antibody (Cat # PAB28424) shows distinct cytoplasmic and membranous positivity with a granular pattern.
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Gene Name:
  • FLOT1
  • Gene Alias:
  • -
  • Gene Description:
  • flotillin 1
  • Gene Summary:
  • Caveolae are small domains on the inner cell membrane involved in vesicular trafficking and signal transduction. FLOT1 encodes a caveolae-associated, integral membrane protein. The function of flotillin 1 has not been determined. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000029208,integral membrane component of caveolae
  • RSS
  • YouTube
  • Linkedin
  • Facebook