Product Browser

Last updated: 2016/9/25

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PCTK1 polyclonal antibody

  • Catalog # : PAB28420
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant PCTK1.
  • Immunogen:
  • Recombinant protein corresponding to human PCTK1.
  • Sequence:
  • MDRMKKIKRQLSMTLRGGRGIDKTNGAPEQIGLDESGGGGGSDPGEAPTRAAPGELRSARGPLSSAPEIVHEDLKMGSDGESDQASATSSDEVQSPVRVRMRNHPPRKISTEDINKRLSLPAD
  • Host:
  • Rabbit
  • Reactivity:
  • Human, Mouse, Rat
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Western Blot (1:100-1:250)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4 °C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western blot analysis of lane 1: NIH-3T3 cell lysate and lane 2: NBT-II cell lysate using PCTK1 polyclonal antibody (Cat # PAB28420).
  • Western Blot
  • Western Blot
  • Western blot analysis of lane 1: RT-4, lane 2: EFO-21, lane 3: A-431, lane 4: Liver and lane 5: Tonsil using PCTK1 polyclonal antibody (Cat # PAB28420).
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) of human small intestine with PCTK1 polyclonal antibody (Cat # PAB28420) shows moderate cytoplasmic positivity in glandular cells, with additional strong membranous positivity.
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 5127
  • Gene Name:
  • PCTK1
  • Gene Alias:
  • FLJ16665,PCTAIRE,PCTAIRE1,PCTGAIRE
  • Gene Description:
  • PCTAIRE protein kinase 1
  • Gene Summary:
  • The protein encoded by this gene belongs to the cdc2/cdkx subfamily of the ser/thr family of protein kinases. It may play a role in signal transduction cascades in terminally differentiated cells. This gene is thought to escape X inactivation. Alternative splicing results in two transcript variants encoding different isoforms. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000023208,OTTHUMP00000023209,PCTAIRE-motif protein kinase 1,serine/threonine-protein kinase
  • RSS
  • YouTube
  • Linkedin
  • Facebook