Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

OSBPL8 polyclonal antibody

  • Catalog # : PAB28410
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant OSBPL8.
  • Immunogen:
  • Recombinant protein corresponding to human OSBPL8.
  • Sequence:
  • LDPLTGEWHYKFADTRPWDPLNDMIQFEKDGVIQTKVKHRTPMVSVPKMKHKPTRQQKKVAKGYSSPEPDIQDSSGSEAQSVKPSTRRKKGIELGDIQSSIESIKQTQEEIKRNIMALRNHLVSSTPATDY
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
    Immunofluorescence (1-4 ug/ml)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4 °C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) of human testis with OSBPL8 polyclonal antibody (Cat # PAB28410) shows strong cytoplasmic positivity in cells in seminiferus ducts.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescence of A-431 cell line with OSBPL8 polyclonal antibody (Cat # PAB28410) shows positivity in nucleus but not nucleoli, cytoplasm and vesicles. Fixation/Permeabilization: PFA/Triton X-100
  • Application Image
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Gene Name:
  • OSBPL8
  • Gene Alias:
  • DKFZp686A11164,MGC126578,MGC133203,MST120,MSTP120,ORP8,OSBP10
  • Gene Description:
  • oxysterol binding protein-like 8
  • Gene Summary:
  • This gene encodes a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Like most members, the encoded protein contains an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • OSBP-related protein 8,oxysterol-binding protein-like protein 8,oxysterol-binding protein-related protein 8
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook