TRIB2 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western blot analysis of lane 1: NIH-3T3 cell lysate and lane 2: NBT-II cell lysate using TRIB2 polyclonal antibody (Cat # PAB28409).
Western Blot
Western blot analysis of lane 1: RT-4, lane 2: U-251 MG, lane 3: A-431, lane 4: Liver and lane 5: Tonsil using TRIB2 polyclonal antibody (Cat # PAB28409).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) of human spleen with TRIB2 polyclonal antibody (Cat # PAB28409) shows strong cytoplasmic positivity in cells in red pulp and white pulp.
Immunofluorescence
Immunofluorescence of U251 MG cell line with TRIB2 polyclonal antibody (Cat # PAB28409) shows positivity in nucleus but not nucleoli and cytoplasm. Fixation/Permeabilization: PFA/Triton X-100
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant TRIB2.
Immunogen
Recombinant protein corresponding to human TRIB2.
Sequence
TIARYGRSRNKTQDFEELSSIRSAEPSQSFSPNLGSPSPPETPNLSHCVSCIGKYLLLEPLEGDHVFRAVHLHSGEELVCKVFDISCYQESLAPCFCLSAHSNINQITEIILGETKAYVFFERSYGDMHSFVRTCKKLRE
Host
Rabbit
Reactivity
Human, Mouse, Rat
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Western Blot (Human: 1:250-1:500, Rodent: 1:100-1:500)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4 °C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western blot analysis of lane 1: NIH-3T3 cell lysate and lane 2: NBT-II cell lysate using TRIB2 polyclonal antibody (Cat # PAB28409).Western Blot
Western blot analysis of lane 1: RT-4, lane 2: U-251 MG, lane 3: A-431, lane 4: Liver and lane 5: Tonsil using TRIB2 polyclonal antibody (Cat # PAB28409).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) of human spleen with TRIB2 polyclonal antibody (Cat # PAB28409) shows strong cytoplasmic positivity in cells in red pulp and white pulp.Immunofluorescence
Immunofluorescence of U251 MG cell line with TRIB2 polyclonal antibody (Cat # PAB28409) shows positivity in nucleus but not nucleoli and cytoplasm. Fixation/Permeabilization: PFA/Triton X-100 -
Gene Info — TRIB2
Entrez GeneID
28951Protein Accession#
B5MCX4Gene Name
TRIB2
Gene Alias
C5FW, GS3955, TRB2
Gene Description
tribbles homolog 2 (Drosophila)
Omim ID
609462Gene Ontology
HyperlinkGene Summary
This gene encodes one of three members of the Tribbles family. The Tribbles members share a Trb domain, which is homologous to protein serine-threonine kinases, but lacks the active site lysine and probably lacks a catalytic function. The Tribbles proteins interact and modulate the activity of signal transduction pathways in a number of physiological and pathological processes. This Tribbles member induces apoptosis of cells mainly of the hematopoietic origin. It has been identified as a protein up-regulated by inflammatory stimuli in myeloid (THP-1) cells, and also as an oncogene that inactivates the transcription factor C/EBPalpha (CCAAT/enhancer-binding protein alpha) and causes acute myelogenous leukemia. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq
Other Designations
tribbles homolog 2
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com