MPST polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western blot analysis of lane 1: NIH-3T3 cell lysate and lane 2: NBT-II cell lysate using MPST polyclonal antibody (Cat # PAB28403).
Western Blot
Western blot analysis of lane 1: RT-4, lane 2: EFO-21, lane 3: A-431, lane 4: Liver and lane 5: Tonsil using MPST polyclonal antibody (Cat # PAB28403).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) of human duodenum with MPST polyclonal antibody (Cat # PAB28403) shows strong cytoplasmic positivity in glandular cells.
Immunofluorescence
Immunofluorescence of A-431 cell line with MPST polyclonal antibody (Cat # PAB28403) shows positivity in mitochondria. Fixation/Permeabilization: PFA/Triton X-100
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant MPST.
Immunogen
Recombinant protein corresponding to human MPST.
Sequence
AVSLLDGGLRHWLRQNLPLSSGKSQPAPAEFRAQLDPAFIKTYEDIKENLESRRFQVVDSRATGRFRGTEPEPRDGIEPGHIPGTVNIPFTDFLSQEGLEKSPEEIRHLFQEKKVDLSKPLVATCGSGVTACHVALGAYLCGKPD
Host
Rabbit
Reactivity
Human, Mouse, Rat
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Western Blot (1:100-1:250)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000-1:2500)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4 °C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western blot analysis of lane 1: NIH-3T3 cell lysate and lane 2: NBT-II cell lysate using MPST polyclonal antibody (Cat # PAB28403).Western Blot
Western blot analysis of lane 1: RT-4, lane 2: EFO-21, lane 3: A-431, lane 4: Liver and lane 5: Tonsil using MPST polyclonal antibody (Cat # PAB28403).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) of human duodenum with MPST polyclonal antibody (Cat # PAB28403) shows strong cytoplasmic positivity in glandular cells.Immunofluorescence
Immunofluorescence of A-431 cell line with MPST polyclonal antibody (Cat # PAB28403) shows positivity in mitochondria. Fixation/Permeabilization: PFA/Triton X-100 -
Gene Info — MPST
Entrez GeneID
4357Protein Accession#
P25325Gene Name
MPST
Gene Alias
MGC24539, MST, TST2
Gene Description
mercaptopyruvate sulfurtransferase
Omim ID
602496Gene Ontology
HyperlinkGene Summary
This protein encoded by this gene catalyzes the transfer of a sulfur ion from 3-mercaptopyruvate to cyanide or other thiol compounds. It may be involved in cysteine degradation and cyanide detoxification. There is confusion in literature between this protein (mercaptopyruvate sulfurtransferase, MPST), which appears to be cytoplasmic, and thiosulfate sulfurtransferase (rhodanese, TST, GeneID:7263), which is a mitochondrial protein. Deficiency in MPST activity has been implicated in a rare inheritable disorder known as mercaptolactate-cysteine disulfiduria (MCDU). Alternatively spliced transcript variants encoding same or different isoforms have been identified for this gene. [provided by RefSeq
Other Designations
3-mercaptopyruvate sulfurtransferase|OTTHUMP00000028670|human liver rhodanese
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com