Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MYH7 polyclonal antibody

  • Catalog # : PAB28402
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant MYH7.
  • Immunogen:
  • Recombinant protein corresponding to human MYH7.
  • Sequence:
  • ALRKKHADSVAELGEQIDNLQRVKQKLEKEKSEFKLELDDVTSNMEQIIKAKANLEKMCRTLEDQMNEHRSKAEETQRSVNDLTSQRAKLQTENGELSRQLDEKEALISQLTRGKLTYTQQLEDLKRQLEEEVKAKNALAHALQS
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
    Immunofluorescence (1-4 ug/ml)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4 °C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) of human heart muscle with MYH7 polyclonal antibody (Cat # PAB28402) shows strong cytoplasmic positivity in myocytes.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescence of U251 MG cell line with MYH7 polyclonal antibody (Cat # PAB28402) shows positivity in nucleus but not nucleoli, cytoplasm and focal adhesions. Fixation/Permeabilization: PFA/Triton X-100
  • Application Image
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 4625
  • Gene Name:
  • MYH7
  • Gene Alias:
  • CMD1S,CMH1,DKFZp451F047,MGC138376,MGC138378,MPD1,MYHCB,SPMD,SPMM
  • Gene Description:
  • myosin, heavy chain 7, cardiac muscle, beta
  • Gene Summary:
  • Muscle myosin is a hexameric protein containing 2 heavy chain subunits, 2 alkali light chain subunits, and 2 regulatory light chain subunits. This gene encodes the beta (or slow) heavy chain subunit of cardiac myosin. It is expressed predominantly in normal human ventricle. It is also expressed in skeletal muscle tissues rich in slow-twitch type I muscle fibers. Changes in the relative abundance of this protein and the alpha (or fast) heavy subunit of cardiac myosin correlate with the contractile velocity of cardiac muscle. Its expression is also altered during thyroid hormone depletion and hemodynamic overloading. Mutations in this gene are associated with familial hypertrophic cardiomyopathy, myosin storage myopathy, dilated cardiomyopathy, and Laing early-onset distal myopathy. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000027949,beta-myosin heavy chain,myhc-slow,myopathy, distal 1,myosin heavy chain (AA 1-96),myosin, heavy polypeptide 7, cardiac muscle, beta,rhabdomyosarcoma antigen MU-RMS-40.7A
  • RSS
  • YouTube
  • Linkedin
  • Facebook