Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DGCR14 polyclonal antibody

  • Catalog # : PAB28398
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant DGCR14.
  • Immunogen:
  • Recombinant protein corresponding to human DGCR14.
  • Sequence:
  • LRVEGSETPYVDRTPGPAFKILEPGRRERLGLKMANEAAAKNRAKKQEALRRVTENLASLTPKGLSPAMSPALQRLVSRTASKYTDRALRASYTPSPARSTHLKTPASGLQTPTSTPAPGSATRTPLTQDPASITDNL
  • Host:
  • Rabbit
  • Reactivity:
  • Human, Mouse, Rat
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Western Blot (1:250-1:500)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4 °C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western blot analysis of lane 1: NIH-3T3, lane 2: NBT-II, and lane 3: PC12 cell lysates using DGCR14 polyclonal antibody (Cat # PAB28398).
  • Western Blot
  • Western Blot
  • Western blot analysis of lane 1: RT-4, lane 2: U-251 MG, lane 3: A-431, and lane 4: Liver using DGCR14 polyclonal antibody (Cat # PAB28398).
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) of human prostate with DGCR14 polyclonal antibody (Cat # PAB28398) shows strong nuclear positivity in glandular cells.
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 8220
  • Gene Name:
  • DGCR14
  • Gene Alias:
  • DGCR13,DGS-H,DGS-I,DGSH,DGSI,ES2,Es2el
  • Gene Description:
  • DiGeorge syndrome critical region gene 14
  • Gene Summary:
  • This gene is located within the minimal DGS critical region (MDGCR) thought to contain the gene(s) responsible for a group of developmental disorders. These disorders include DiGeorge syndrome, velocardiofacial syndrome, conotruncal anomaly face syndrome, and some familial or sporadic conotruncal cardiac defects which have been associated with microdeletion of 22q11.2. The encoded protein may be a component of C complex spliceosomes, and the orthologous protein in the mouse localizes to the nucleus. [provided by RefSeq
  • Other Designations:
  • DiGeorge syndrome critical region gene 13,DiGeorge syndrome critical region gene DGSI,DiGeorge syndrome critical region protein 14,DiGeorge syndrome gene H,DiGeorge syndrome gene I,Protein DGCR13
  • RSS
  • YouTube
  • Linkedin
  • Facebook