RNF139 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western blot analysis of HEK293T cell lysate using RNF139 polyclonal antibody (Cat # PAB28393).
Lane 1: Negative control (vector only)
Lane 2: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) of human testis with RNF139 polyclonal antibody (Cat # PAB28393) shows strong cytoplasmic positivity in cells in seminiferus ducts.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant RNF139.
Immunogen
Recombinant protein corresponding to human RNF139.
Sequence
PEIKGSRLQEINDVCAICYHEFTTSARITPCNHYFHALCLRKWLYIQDTCPMCHQKVYIEDDIKDNSNVSNNNGFIPPNETPEEAVREAAAESDRELNEDDSTDCDDDVQRERNGVIQHTGAAAEEF
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Western Blot (1:100-1:250)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4 °C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Transfected lysate)
Western blot analysis of HEK293T cell lysate using RNF139 polyclonal antibody (Cat # PAB28393).
Lane 1: Negative control (vector only)
Lane 2: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa)Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) of human testis with RNF139 polyclonal antibody (Cat # PAB28393) shows strong cytoplasmic positivity in cells in seminiferus ducts. -
Gene Info — RNF139
Entrez GeneID
11236Protein Accession#
Q8WU17Gene Name
RNF139
Gene Alias
HRCA1, MGC31961, RCA1, TRC8
Gene Description
ring finger protein 139
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a multi-membrane spanning protein containing a RING-H2 finger. This protein is located in the endoplasmic reticulum, and has been shown to possess ubiquitin ligase activity. This gene was found to be interrupted by a t(3:8) translocation in a family with hereditary renal and non-medulary thyroid cancer. Studies of the Drosophila counterpart suggested that this protein may interact with tumor suppressor protein VHL, as well as with COPS5/JAB1, a protein responsible for the degradation of tumor suppressor CDKN1B/P27KIP. [provided by RefSeq
Other Designations
multiple membrane spanning receptor TRC8|patched related protein translocated in renal cancer
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com