Product Browser

Last updated: 2017/5/21

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

LUM polyclonal antibody

  • Catalog # : PAB28382
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant LUM.
  • Immunogen:
  • Recombinant protein corresponding to amino acids of human LUM.
  • Sequence:
  • DFPLSIYGQSSPNCAPECNCPESYPSAMYCDELKLKSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGRVFSKLKQLKKLHINHNNLTESVGPLPKSLEDLQLTHNKITKLGSFEGLVNLTF
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (1:200-1:500)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining of human prostate with LUM polyclonal antibody (Cat # PAB28382) shows moderate cytoplasmic positivity in glandular cells at 1:200-1:500 dilution.
  • Application Image
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 4060
  • Gene Name:
  • LUM
  • Gene Alias:
  • LDC,SLRR2D
  • Gene Description:
  • lumican
  • Gene Summary:
  • This gene encodes a member of the small leucine-rich proteoglycan (SLRP) family that includes decorin, biglycan, fibromodulin, keratocan, epiphycan, and osteoglycin. In these bifunctional molecules, the protein moiety binds collagen fibrils and the highly charged hydrophilic glycosaminoglycans regulate interfibrillar spacings. Lumican is the major keratan sulfate proteoglycan of the cornea but is also distributed in interstitial collagenous matrices throughout the body. Lumican may regulate collagen fibril organization and circumferential growth, corneal transparency, and epithelial cell migration and tissue repair. [provided by RefSeq
  • Other Designations:
  • lumican proteoglycan
  • RSS
  • YouTube
  • Linkedin
  • Facebook